KEGG   Solanum tuberosum (potato): 102581005Help
Entry
102581005         CDS       T02981                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00052  Galactose metabolism
sot00500  Starch and sucrose metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102581005
   00500 Starch and sucrose metabolism
    102581005
Enzymes [BR:sot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102581005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102581005
NCBI-ProteinID: XP_006359350
UniProt: M1BB96
LinkDB All DBs
Position
Un
AA seq 896 aa AA seqDB search
MNNHTTNKFCIILIFSKYFILFFTFLVPLLALLTKSEQVGYGYIVRSVGVGSSGRTLTAY
LQLIKSSSVFGTDIQNLTLTACFETKDRLRVRITDADHERWEVPREFIPRETHLSPRSSL
LEKRSSTSLPLSEDTHYFHTDTVSDLTFTLYNTTPFGFTITRHSTGDVLFDTTPENDSPD
TFLIFKDQYLQLSSSLPANRSSIYGLGEHTKRNFKLKHNQTLTLWNSDISSANVDLNLYG
SHPFYMDVRSHPGAGTSHGVLLFNSNGMDIVYAGDRITYKVIGGIIDLYFFAGPVPELVM
EQYTELIGRPAPMPYWSFGFHQCRYGYKDITEIKNVVAGYAKAQIPLEVMWTDIDHMDGY
KDFTLDPINFPLDQMKKFVDTLHHNGQKFVLIVDPGISINSSYETYKRGMQADIFIKRDG
VPYLGEVWPGKVYFPDFINPQGRVFWSNEIKIFHDLLPVDGLWLDMNELSNFISSPPSPS
STLDNPPYKINNSGSLRPINEKTVPATSVHFGNALEYNVHNLYGFLEAKTTNAALIDVTG
KRPFILSRSTFVGAGKYTAHWTGDNAATWDDLAYSIPGILNSGLFGIPMVGADICGFGRN
TTEELCRRWIQLGAFYPFARDHSDKFTIHQELYIWDSVAATARKVLGLRYRLLPYFYTLM
FEAHTKGVPIARPLFFSFPEDTNTYAIDTQFLIGKGLMISPVLTSGEVSVNAYFPSGTWF
NLFNYSNYVNMKSGSYISLDAPPDHINVHLREGNIVVMQGEAMTTRAARDTPFELVVAIN
NRGNSSGEVFLDDGEDVEMGGEGGKWCLVKFHTNVVNKKLYLRSNVVNEEFALSKNWTIH
KVTFLGLKKGVSKINAYNLTTKIRTKNDKSAFGVLEMRDLSVLIGKEFTIELTLEK
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccacacaactaataaattttgtattattcttattttctctaaatattttatc
ttgttcttcacttttttggttccattattagcacttctaacaaaatctgaacaagttgga
tatggatatattgttagatcagtaggcgttggctcatctggaaggacgttgactgcttat
cttcagctcatcaaaagttcctctgtttttggaactgacattcaaaatctcacccttact
gcttgctttgagacgaaagaccgtttaagagtcagaattacggatgctgatcatgaaaga
tgggaagttcctcgagaatttatcccccgggaaactcatttatccccccgaagctccctc
ttggaaaagcgttcttctacctcacttccattatcagaagacacacactacttccataca
gacaccgtttcggaccttactttcactctctacaataccaccccttttggctttactatc
acgcgtcactccacaggtgacgttctttttgacaccacacctgaaaatgactctccggac
acgttcctcatcttcaaggatcagtaccttcaattgtcctcttcattgccagccaatagg
tcatctatttatggtctcggggagcataccaagagaaattttaagctcaagcataatcag
acattgactctttggaattctgatattagtagcgctaatgttgatctcaacttgtatggt
tcccaccctttttacatggatgtcaggtctcatcctggcgcggggactagtcacggagtc
ttgctgttcaatagcaatggcatggacattgtatatgctggtgacagaattacttacaag
gtgattggtgggatcattgacttgtacttctttgctggtcctgtgccagagttagtcatg
gaacagtacacagagctcattggccgcccagcgcccatgccatactggtcttttggattt
caccaatgccgttatggttataaagacattactgaaattaagaatgtggttgctggctat
gcgaaagctcagatccctcttgaggtcatgtggacagatattgatcatatggatggttat
aaggatttcacactcgatcctattaacttcccacttgaccagatgaagaaatttgttgat
acacttcatcacaatggccagaaatttgttctcatagtggatccagggatcagcataaat
agctcatatgagacatacaagagagggatgcaagcagacattttcatcaaacgcgatggt
gtcccttatctcggcgaagtttggcctggaaaagtctactttcctgatttcataaatccc
caaggcagagtcttctggagtaatgaaatcaagattttccatgaccttctccccgtcgat
gggctctggcttgacatgaacgagttatctaacttcatttcttctcctccgagcccttct
tctacccttgacaaccctccttataagatcaataactccggaagcttacgtccaataaat
gagaagactgtcccagcaacatcagtacatttcgggaatgccttagagtacaatgttcat
aacctctacggattcctggaagctaaaactaccaatgctgctttaatcgatgttactggt
aaaagaccatttatacttagcagatctacctttgtgggtgctggaaagtacacggcacat
tggactggagacaatgcagccacatgggatgatttggcttatagtattcccggcattttg
aattctggattgtttgggattcccatggttggagctgatatatgtggctttggtagaaat
actactgaagaattatgtcgccgttggattcagctaggtgcattttatccctttgcaagg
gatcactctgacaagttcactatccatcaagagctatatatctgggattcagtagctgca
acagccagaaaggtgctcggactacggtatcgtctcttaccatacttctacacgctaatg
ttcgaggcacacaccaaaggcgtccctatagcgcgtcctcttttcttttcatttcccgag
gatacaaacacttacgccatcgacactcagtttctcatcggtaaggggttaatgatatca
ccagtactgacatctggagaagtttcagttaacgcgtatttcccatctggtacctggttc
aacctctttaactattcaaactacgtgaatatgaagtccggtagctacatcagtctagac
gcgcctcctgatcatatcaacgtgcacctcagggagggaaacattgtagtgatgcaagga
gaagcaatgacaacaagagcagcccgggatactccgtttgaacttgttgtcgccatcaac
aacaggggaaatagttcaggggaagtcttcttggacgatggcgaagacgttgaaatggga
ggagagggaggaaaatggtgcctagtgaaatttcacactaatgttgtgaataagaagtta
tatttaagatcaaatgttgtgaatgaagagtttgctttgagtaagaattggacaatacac
aaagtgacttttcttggactgaaaaaaggggtgagtaaaataaatgcatataatttgact
actaaaattagaacaaaaaatgataaaagtgcatttggtgttttggagatgagagatcta
tcagttcttattggaaaagaatttactattgagctaacacttgaaaaataa

DBGET integrated database retrieval system