KEGG   Solanum tuberosum (potato): 102586190Help
Entry
102586190         CDS       T02981                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00220  Arginine biosynthesis
sot00250  Alanine, aspartate and glutamate metabolism
sot00260  Glycine, serine and threonine metabolism
sot00630  Glyoxylate and dicarboxylate metabolism
sot00710  Carbon fixation in photosynthetic organisms
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
sot01210  2-Oxocarboxylic acid metabolism
sot01230  Biosynthesis of amino acids
Module
sot_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sot_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    102586190
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102586190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102586190
   00260 Glycine, serine and threonine metabolism
    102586190
   00220 Arginine biosynthesis
    102586190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sot01007]
    102586190
Enzymes [BR:sot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102586190
    2.6.1.4  glycine transaminase
     102586190
    2.6.1.44  alanine---glyoxylate transaminase
     102586190
Amino acid related enzymes [BR:sot01007]
 Aminotransferase (transaminase)
  Class I
   102586190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Exo70
Motif
Other DBs
NCBI-GeneID: 102586190
NCBI-ProteinID: XP_006357614
UniProt: M1BLM4
LinkDB All DBs
Position
Un
AA seq 481 aa AA seqDB search
MSSKALDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVIALCQAPFLLDDPNVGLIFPADAIARAKQFLGMTSGGLGAYSDSRGIPGVRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNSIIRGPSDGILVPVPQYPLYSASIQLLGGSLV
PYYLEETANWGLDINDLRQSVAQARYKGITVRAMVIINPGNPTGQCLSVANLKQIIQFCH
QENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL
ESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETANKLGKAADVFYCLRL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaggcattggactatgagaatctgaacgaaaatgtcaagaagtgccaatat
gctgtcagaggtgagctgtaccttcgagcttctgagcttcagaaggaaggcaaaaagatc
atcttcacgaatgttggtaacccccatgcccttgggcagaagccactgacatttccacgc
caggtcattgctctctgtcaagctccatttttactggatgatccgaatgtgggactcata
ttccctgctgatgcaattgcaagggctaaacagtttcttgggatgacttctggtggtcta
ggtgcttatagtgactcccgaggcattcccggtgtaaggaaagaagttgcagaattcatt
gagagacgtgatggatatccaagtgatccagaactcatatttctcacagatggtgccagc
aaaggagtgatgcagatcttgaacagtatcattcgcggcccaagtgatgggatattggtc
cctgttccccagtatccactatactcagcttcaatacaattattggggggttctcttgtt
ccttactaccttgaagagactgcaaactggggtcttgatatcaatgaccttcgccaatca
gttgcacaggcacgatacaagggaataactgtacgagctatggtgattataaaccctgga
aatcccactggacaatgtcttagtgtggcaaatcttaagcaaattattcaattctgccac
caagaaaatttagttttacttggagatgaagtttatcagcaaaacatttaccaagatgag
cgccccttcataagtgcaagaaaggttttattggatatgggactaccattaagcaaggag
gttcagcttgtctcatttcacactgtctccaaaggatattggggtgaatgtggacagcgt
ggaggatactttgagatgaccaacattcctccaaaggccgttgaagaaatatacaaggtt
gcttcaatttcactcagtccaaatgtacctggacagatatttatggggctcatggtgaac
ccccctaaacctggagatatctcatatgaccaatatgtcagagagagtaagggtatcctc
gagtcattaaggaggagggcacacatgatgactgatggtttcaacagctgcagaaatgtt
gtttgcaatttcacagaaggtgcaatgtattccttcccgcaaatacgattgcctcctaga
gcaatagagactgcaaacaagcttgggaaagctgctgatgttttctattgtctgaggctg
ttggaagcaactggcatctccactgtccctggttcaggtttcggtcaaaaggaaggggtg
ttccatctaaggacaaccatcttgccagctgaagaagacatgccagcaattatggaaagt
ttcaaaaagttcaatgatgaattcatggagaaatatgaagaccacaaaggttattccagg
atgtaa

DBGET integrated database retrieval system