KEGG   Solanum tuberosum (potato): 102587367Help
Entry
102587367         CDS       T02981                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00071  Fatty acid degradation
sot00592  alpha-Linolenic acid metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01212  Fatty acid metabolism
Module
sot_M00087  beta-Oxidation
sot_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102587367
   00592 alpha-Linolenic acid metabolism
    102587367
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     102587367
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     102587367
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     102587367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 MORN
Motif
Other DBs
NCBI-GeneID: 102587367
NCBI-ProteinID: XP_006365183
LinkDB All DBs
Position
Un
AA seq 710 aa AA seqDB search
MANKGSINMEIGNDGVAVITMINPPVNALTLSAIEELKRFYQEAIDCDNVKAIVLSGANG
RFCGGLDISVMENVHKHGDISLLPDASIGLVVNKIENGNKPSVAAIQGFALGGGLELAMG
CSARIATPKCDLGLPELKLGVIPGCGGTQRLPRLVGTSKAVDMLMSSKTITSDEGKELGL
IDAIVSSEELLIVARCWALDIVEGRHPNCNSLEKTDKLGPKDESLEILKSARQRYTVPRY
RACLDVIEEGIVAGGYAGVLKEDKVFKELVLSNTAKGLLHVFLSELATTKVPSVTDIGLK
PRRIEKVAVVGGGLMGSGIATALIISNISVVLKEINHEYLSKALKSVEANLQGFVTRGKL
NQDKMKRTLSLLKGTLDYEDLKDVDMVIEAVNENVSLKQSIFEDIEKVCTSECIFASNTS
TISLDVIGKRTSSQDRILGIHLFSPAHLMPLVEIVRTENTSPQVIVDVIKFTKILKKVPI
VVKNCTGFAVNRSFFPYMQGPDLLANLGVDIFRIDRVITEFGMRLGPFQLQDLTGYGIFL
AGVEEFVAAYPDRAFQSPLVQLMVENGREGKKNGKGYYTYNKGSKPEADHSVLQIVEESM
RLTNIAPAGKPISVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPSET
GGVMFWADTIGCEYIYSKLKGWYEAYGDFFKPSTFLEQKAAKGLPLGGSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataagggttctatcaatatggaaattgggaatgatggtgtggctgttatcact
atgattaatccacctgttaatgccttaactctctcagcaattgaggagttgaagagattc
tatcaagaggctattgattgcgataacgtgaaggccattgttctttctggtgcgaatggt
agattttgcggaggtttggacatcagtgttatggagaatgttcataagcatggagatata
tcacttctacctgatgcatcgattggtctagtggttaataaaatcgaaaatgggaataag
ccttctgttgctgcaattcaaggatttgctcttggtggtggtttggagttggctatgggg
tgtagtgctcgaattgccacgccaaaatgtgatcttggtttacctgagttgaagcttgga
gttattccaggatgtggaggcactcaaaggcttccaaggctagttgggacctcaaaggct
gttgatatgttgatgtcatccaagactataacttctgatgaggggaaggagttgggtctt
attgatgccattgtctcttcagaggagctcttgatagttgctcggtgttgggcacttgac
attgttgaaggccgccatccaaattgtaattctcttgaaaagacggataaacttggacct
aaggatgagtcacttgagatactgaaaagtgctagacaacgttatacagtgcctcgttat
agagcctgtcttgatgtgatcgaagaaggcattgtagctggaggatatgctggtgttctt
aaggaagataaggtatttaaagagctagtgttgtcaaatactgcaaaaggtcttcttcat
gtatttctatccgaacttgcaacaacaaaggtaccaagtgttactgatattgggcttaag
cctcggagaatagaaaaagttgcagttgttggtggtggattaatgggatctggcattgct
acagctctcattatcagcaacattagtgttgtacttaaagaaattaaccatgaatattta
tcgaaagctttgaaatcagtagaagcaaatctacaaggctttgtaacaagaggaaagctg
aatcaggataagatgaaaaggactttgtctcttcttaaaggcactttagactatgaagac
ttgaaagacgtcgacatggttattgaggctgttaacgagaatgtgtctctgaaacaatca
atttttgaggatattgagaaagtttgtacttcagagtgcatttttgcatcaaacacatct
acaattagtcttgatgtgattgggaaaagaacaagtagccaagatcgcattttggggata
catttattcagtcctgcacatttgatgcctctggtagaaatcgtgaggacagaaaatact
tctccacaagtaattgttgatgtgataaaattcactaagattttgaagaaagtccccatt
gtagtgaaaaattgtactggttttgctgtcaaccggagcttcttcccttatatgcaagga
ccagacctgttggcaaatttaggcgttgatatcttcagaattgaccgcgttatcactgag
tttggcatgcgacttggtccttttcagcttcaggatcttaccggctatggtatatttttg
gctggtgtagaagagtttgttgctgcttatccagaccgtgcttttcagtctccattggtt
caactaatggtagaaaatggacgggaaggtaagaagaatggtaaaggatattacacgtat
aataaaggaagcaagccagaagctgatcactctgtgctacaaatcgttgaggagtctatg
agacttaccaatattgctcctgctggaaagccaatatctgtgacagatgaagaaattcta
gaaatgatattctttccagtggtgaatgaggcttgtcgagttattgaggaaggaatagtt
gtccgagcatctgatattgacattgcatctgtccatggattcaaatttccctcagaaact
ggaggcgtcatgttttgggctgatacgattggatgtgagtacatatactcgaagttaaaa
ggttggtatgaggcatatggtgatttctttaagccatcaacattcttggaacagaaagct
gcaaaaggtctacccttgggaggatcgtgttga

DBGET integrated database retrieval system