KEGG   Solanum tuberosum (potato): 102588758Help
Entry
102588758         CDS       T02981                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00220  Arginine biosynthesis
sot00250  Alanine, aspartate and glutamate metabolism
sot00710  Carbon fixation in photosynthetic organisms
sot01100  Metabolic pathways
sot01200  Carbon metabolism
sot01210  2-Oxocarboxylic acid metabolism
sot01230  Biosynthesis of amino acids
Module
sot_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102588758
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102588758
   00220 Arginine biosynthesis
    102588758
Enzymes [BR:sot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102588758
Amino acid related enzymes [BR:sot01007]
 Aminotransferase (transaminase)
  Class I
   102588758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102588758
NCBI-ProteinID: XP_006342897
LinkDB All DBs
Position
Un
AA seq 545 aa AA seqDB search
MRRFVADKAKTLISRSRTTCSSSSPITTSTSVLQRLTSSSSQSQSPAVLRFLSTSSDSMA
SDYSSTPITLNNVNPKVLKCEYAVRGEIVNLAQKLQQDLKDNPGSHPFDEILYCNIGNPQ
SLAQQPITFFREVLALCDHPLILDKSETQGLFSADSIERAFQILDQIPGRATGAYSHSQG
IKGLRDTIASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLY
SASIALHGGTLVPYYLDEETGWGLEVSELENQLKTAKSKGINVRALAVINPGNPTGQVLA
EANQREIVEFCKKEGLVLLADEVYQENVYVPEKQFHSFKKVARSMGFGEKDISLVSFQSV
SKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESY
ESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPNKAIKAAEEAK
TAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRLTEFHKQFM
DEFRG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtagctgataaagccaagactctcatcagtaggagcaggaccacctgt
tcgtcttcttctcctattactacttctacttccgtgttgcagcggctcacctcttcttct
tctcaatcacaatcacctgctgttcttcgttttttatccacttcttctgattcaatggct
tccgattattcatccactccgatcactcttaacaacgttaatccaaaggttttgaaatgt
gagtatgctgtccgcggagaaatcgtcaaccttgctcagaaattacaacaagacctcaag
gataatccaggctctcatccctttgatgagatcttatactgcaatattggaaatcctcaa
tccctggctcagcagcctattactttctttagggaggtccttgcattatgtgatcatcca
cttattttggacaaaagtgaaacgcaaggtttgttcagtgcggattcaatagaacgagct
ttccagatcctcgaccaaattcctggtagagcaacaggtgcatacagccacagtcagggt
atcaaaggattacgtgatacaattgcttctggtatcgaagctcgtgatggcttccctgct
gatccaaatgatatcttcttgactgatggtgcaagccctgcggttcacatgatgatgcag
ttgctcatcgggtcagagaatgatggaattctctgtcccatcccccaatatcctctttat
tccgcttcaattgctctccatggtggcactctcgttccttattatcttgatgaggaaacc
ggatggggacttgaggtctcagagcttgagaatcagctgaaaactgcaaaatccaagggg
attaacgttagggctttggctgtgatcaatccaggcaacccaactgggcaggttcttgct
gaggctaaccaacgagaaattgtggaattctgcaagaaagaaggccttgttcttctggcg
gatgaagtgtatcaggaaaatgtttatgtgcctgagaagcagttccactcatttaagaaa
gttgcgcgctctatgggatttggagaaaaggacatctctttagtttcttttcagtctgtg
tcaaaaggattctatggagagtgtggaaagcgaggaggttacatggaggttactggattt
agccctgagataagggaacagatatacaaagtggcatctgtcaatctgtgttccaacatt
tctggtcagattcttgcaagccttgtcatgagccctccaaaggtgggtgatgaatcatac
gaatcttttgctgctgaaaaagaagggatactctcatccttggcaagacgtgcgaagaca
ctagaagatgcattcagcaatttggagggagtaacatgcaataaagcagagggtgcaatg
tatctatttccacgcatcaacttacccaacaaagcaataaaagcagcagaagaagctaaa
actgcaccagatgcattttatgctcggcgcctccttaatgccactggaattgttgttgtc
ccaggctctggatttggccagcgtcctggaacgtggcattttaggtgcacaatattacct
caagaagagaagataccagctattgtatctcgtcttacagaattccataagcagttcatg
gatgaattccgcggctaa

DBGET integrated database retrieval system