KEGG   Solanum tuberosum (potato): 102591315Help
Entry
102591315         CDS       T02981                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00053  Ascorbate and aldarate metabolism
sot00071  Fatty acid degradation
sot00280  Valine, leucine and isoleucine degradation
sot00310  Lysine degradation
sot00330  Arginine and proline metabolism
sot00340  Histidine metabolism
sot00380  Tryptophan metabolism
sot00410  beta-Alanine metabolism
sot00561  Glycerolipid metabolism
sot00620  Pyruvate metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102591315
   00053 Ascorbate and aldarate metabolism
    102591315
   00620 Pyruvate metabolism
    102591315
  Lipid metabolism
   00071 Fatty acid degradation
    102591315
   00561 Glycerolipid metabolism
    102591315
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102591315
   00310 Lysine degradation
    102591315
   00330 Arginine and proline metabolism
    102591315
   00340 Histidine metabolism
    102591315
   00380 Tryptophan metabolism
    102591315
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102591315
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    102591315
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102591315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102591315
NCBI-ProteinID: XP_006345041
UniProt: M1C9T0
LinkDB All DBs
Position
Un
AA seq 535 aa AA seqDB search
MAARRLSSLLSRSLHLPSASASLGRSHGVARHINRFSTAAAVEELITPPVQVNHTKLLIN
GQFVDSASGKTFPTLDPRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSR
IMLKFADLVEKHNDEIAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPA
DGPYHVQTLHEPIGVAGQIIPWNFPLLMMAWKVGPALACGNTIVLKTAEQTPLTALYVAN
LFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTETGQTVLQLAAKSNLKPVT
LELGGKSPFIICEDADVDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARA
MRRVVGDPFKKGVEQGPQIDSEQFKKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVF
SNVKEDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDTANTLTRGL
RAGTVWINCYDIFDAGIPFGGYKMSGTGREKGIYSLNNYLQVKAVVTPLKNPAWI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgtagactttcttctttactctctcgttctctccaccttccttctgcttct
gcttctctaggaagaagccatggtgtggcaaggcacatcaacaggtttagtacagctgca
gctgttgaggaattaatcactccacctgtccaagttaatcacaccaagcttctaatcaat
ggacaatttgttgattctgcatctggaaaaacgttcccaactttggatccaagaactggg
gaagtcatagcaaatgttgctgaaggtgatctcgaagatgttaatcgcgctgtggctgct
gctcgcaaggcatttgacgagggaccatggcccaaaatgagtgcttatgaaaggtcacgg
ataatgctaaagtttgctgatttggtggagaaacacaatgatgagattgcagctttagaa
acatgggataatggcaagccatatttgcaggctgcccaagctgaagtaccttcttttgtg
cgattatttcggtactatgctggttgggcggataaaatccatggtctaactgttccagct
gatgggccataccatgtacaaactttacatgaaccaattggggttgctggtcaaataatt
ccatggaactttccccttcttatgatggcctggaaagttgggcctgccctagcatgcggt
aacactattgtcctgaagactgctgagcaaactccactgactgctctttatgttgcaaac
ttattccatgaggctggtcttcctccaggtgttttaaatattgtttctggtttcggacct
accgctggtgctgcacttgctagtcatatggatgtagacaagcttgctttcactggatca
acggaaactggacaaacagttcttcaactggctgccaaaagcaatctgaaaccagttacc
ctcgaactaggagggaaatcacctttcattatatgtgaggatgctgacgttgatcatgct
gttgagctagcacattttgcactcttctttaatcagggccaatgttgttgtgctggttct
cgtacctatgtacatgaacgagtatatgatgaatttgtagagaaggcaaaggcacgtgca
atgagacgtgtagttggtgatcccttcaagaaaggtgttgaacaaggtcctcagatcgac
tcggagcaatttaagaagatacttaggtacataagagaaggccgtgacagctctgccacc
cttgaatgtggtggtgatagaattggctccaaaggctactttattcagcccactgtgttc
tcaaatgtcaaggaggacatgtcgatagcacaggatgagatttttggtccagtgcaatgt
gtcttcaaattcaaggatattggcgaagtaataaagagagcaaacaacactcgctatggt
ctagcagcaggcgttttcacaaagaacattgacacagcaaacaccttgacccgaggattg
agagctggaacggtgtggatcaactgctatgatatatttgatgctggaattccttttgga
gggtacaagatgagtggcacgggcagggaaaagggtatttacagccttaacaactactta
caggtgaaggctgttgttactccattgaagaatccggcttggatataa

DBGET integrated database retrieval system