KEGG   Solanum tuberosum (potato): 102592748Help
Entry
102592748         CDS       T02981                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102592748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sot03036]
    102592748
Enzymes [BR:sot01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102592748
Chromosome and associated proteins [BR:sot03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102592748
   Polycomb group proteins
    PRC2-EZH2 complex
     102592748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 102592748
NCBI-ProteinID: XP_006361735
UniProt: M1D7T4
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MSPASDNSLSDSQTQRLNDLSIVSPEEATVEPDEVLSVIESLKRRIASERADYIKKRVEG
NTQKLENLTKDLYNLATERKCLEIFDADGRIDLLSKRQKDALDMQNGVDTSNADDDSNSS
EDDGYATSAILLGSSIAVKNAVRPIKLPEVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRI
YYDQNGGETLICSDSDEEVLEEEEEKKVFAESEDYMLRMTVKEVGLSDIVLDLLGQCLSR
KPSEVKARYEGLVKEDDAGTSKNEFTESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRL
HGCSQDLIFPAEKQLPWYCSNADMEPCGPNCFSLAKKFESNATVISPQCASHGEKSILPS
DVANNTQMPGRKHVSRRSKCSKGEGAPNAKNISESSDSDIRPVNDITSNERSSSPSKSKS
DNKDGSNKRNSKRIAEHVLVAIKKRQKKMAVLESDSVASESLGFKDLNLHSISRKENEDA
SPSSQKAQCHSAKRSRKKNSPVLDNKNSLQGKAFGCKLMEVSSAKPVTNCDDTLGKNEYV
GENNCKQEIDGTKSWRPIEKALFEKGLEMFGRSSCLIARNLMNGLKTCWEVFQYMNNSGN
KLFSGTGDGMDGILEGGSNGDGQEIMGNEPRRRSRFLRRRGKVRRLKYTWKSTGYHAIRK
RISERKDQPCRQFNPCGCQGPCGKECSCIVNGTCCEKYCGCPKGCKNRFRGCHCAKSQCR
SRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPLQRGDSHECRNMKLLLKQQQKVLLGRS
DVSGWGAFLKNTVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAHR
KGDKLKFANHSPVPNCYAKVMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARK
PEASGTRKEDAAPSSGRARKHT
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcgtccgataactccctgtcggattctcaaacacaacgtttaaatgatctt
tcgattgtttctcctgaagaagcaactgtagaacctgatgaagtactatcagttattgaa
tctttgaagagaagaattgcttctgaacgtgctgattatattaagaaaagggtagaagga
aatacacaaaagttggagaatttgacaaaggatctttataatttggcaacagagagaaaa
tgtcttgaaatttttgatgctgacggaagaattgatctactatcgaaaagacaaaaggat
gcacttgatatgcaaaatggcgttgataccagtaatgcagatgatgatagtaatagctct
gaagatgatggatacgccacttctgcaattcttttaggatcaagtattgcagtcaagaat
gccgtacggcccattaaacttccagaagtaaaacgcatccctccatatacttcatggata
tttttggatagaaatcagagaatgacagaggatcaatctgtggttggtcgtagaagaatt
tattatgatcagaatggtggggaaactttaatttgtagtgatagtgatgaggaagtactt
gaagaagaagaagaaaagaaggtgtttgcagagtccgaagattatatgctgcgaatgact
gtcaaagaagttggcttgtccgatattgtgttggatttgctaggacagtgcttgtctaga
aaacctagtgaagtgaaggcaagatatgaaggtcttgttaaggaagatgatgcaggcact
tcaaagaatgagttcacggaaagttctttagatttatatcttgccaaagatcttgatgct
gctctggattcttttgataatctattttgtcgtcgatgtcttgtctttgattgtagatta
catggatgttcacaggatcttatatttcctgcggaaaaacaattaccatggtactgctcc
aatgcagatatggagccctgtggaccaaattgcttcagcctggccaaaaagttcgaaagt
aatgctacagtgatctctcctcagtgtgctagtcatggagaaaaatccattctgccatct
gatgttgctaataatactcagatgccaggtaggaagcatgtatcaagaagatcgaagtgt
tcaaaaggtgaaggtgctccaaatgcaaaaaacatctctgagagcagtgattcagatatt
agacccgtaaatgatatcacttctaatgagcgctcttcatctccatcaaaaagcaaatct
gacaataaagatggcagcaacaaaaggaacagcaagcgaatagctgaacatgttctagtt
gccattaagaaaagacagaagaaaatggcagtattagaatctgactctgttgcaagtgaa
agcctaggtttcaaagatttgaatcttcactctatttcacggaaggaaaacgaagatgcg
agtccatcttcacaaaaagcacaatgtcatagtgctaaaaggtctaggaagaaaaactct
ccggttttggacaataaaaattctttgcaaggcaaggcttttggttgcaaattgatggaa
gtttccagtgcaaagcctgtgacaaattgtgatgacacattggggaaaaatgaatatgtg
ggtgagaataactgcaaacaagaaatagatggtactaaatcttggagacccattgaaaag
gctctctttgaaaagggtctagaaatgttcggtagaagcagctgtttgatcgctcgaaac
ctcatgaatggtttgaagacatgctgggaggttttccagtacatgaacaattccgggaat
aagctattctcaggcacaggtgatgggatggatggcattcttgaaggtggttccaatggt
gatggtcaggaaatcatgggtaatgaacctcgaagaagatccagatttttgcgtagaaga
ggcaaagttcgccgattaaaatacacgtggaaatccactggataccatgcaattaggaaa
cggatttctgagaggaaggatcaaccctgtcggcagtttaatccatgtggctgtcaaggc
ccttgtggaaaggagtgttcctgcattgtaaatgggacctgctgtgaaaaatactgtgga
tgcccaaagggttgcaagaacaggtttcgtggttgtcattgtgccaaaagtcagtgtagg
agccgtcaatgcccttgctttgctgctggcagggaatgtgatcctgatgtttgtcgaaat
tgttggatcagttgtggtgatggtacgcttggggttcctctgcaaagaggtgatagtcat
gaatgcaggaatatgaaactacttctcaaacagcaacaaaaggtacttcttggaagatct
gatgtttctggctggggggctttcttgaagaatactgttggaaaacatgaataccttggg
gagtacacaggtgaattaatttcacaccgtgaagctgacaagcgtggcaagatttatgat
cgtgaaaattcttcatttctcttcaatcttaatgatcagtttgtgcttgatgcacaccgg
aagggtgacaaactaaaatttgcgaaccattctcctgttccaaattgctatgctaaggtc
atgatggtggctggagatcacagagttggtatctttgccaatgaaagaatttgcgctgga
gaagaactcttttacgattatcgttatgagccagacagtgcacccgcctgggcaaggaag
cccgaggcatctggtactaggaaagaggatgctgctccttcaagtggtcgtgctaggaag
catacataa

DBGET integrated database retrieval system