KEGG   Solanum tuberosum (potato): 102592754Help
Entry
102592754         CDS       T02981                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00010  Glycolysis / Gluconeogenesis
sot00020  Citrate cycle (TCA cycle)
sot00620  Pyruvate metabolism
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
Module
sot_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102592754
   00020 Citrate cycle (TCA cycle)
    102592754
   00620 Pyruvate metabolism
    102592754
Enzymes [BR:sot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     102592754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 102592754
NCBI-ProteinID: XP_006362562
UniProt: M1AZL8
LinkDB All DBs
Position
Un
AA seq 460 aa AA seqDB search
MASLQSSAISFSSSLGRFSTTRTMLPQKPRNYKLPVVESKIREIFMPALSSTMTEGKIVS
WVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAVIVVNEGETALVGAPIGLLAETED
EIAEAKAKAKGQSGGSSSGSESTPEPQSPVGVSSDEPKKIVATPNAKKLAKQHKIDINKV
NGTGPFGRIISEDVEKAAGITPAPSKSISPPPAAATAAAPAVGTPAKAAPVSLPEIPGST
VVPFTTMQVAVSKNMMESLSVPTFRVGYPVITDALDDLYLKVKKKGVTMTALLAKAAAMA
LAQHPVVNSSCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVE
KARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTPVANADGFFS
VKNKMLVNVTADHRVVYGADLAAFLQTFSKIIENPDSLTM
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacttcaatcctctgcaatctccttctcatcttccctcggtcgtttctcaacc
acacgcacaatgctccctcagaaacccagaaattacaaactcccagttgttgaatcgaag
attcgagagattttcatgccggcattaagctcaacgatgactgaaggaaagatcgtatct
tgggttaaatcggaaggtgatgttttgtctaaaggtgaatcggttgttgttgtggagtcg
gataaagctgatatggatgttgagacgttttacgatgggattttagctgttattgttgtt
aatgaaggtgaaactgcacttgttggtgctcctattgggttattagctgaaacagaagat
gaaattgctgaagctaaagcaaaagcgaaaggacaatctgggggttcttcttctggatcg
gagagtactcctgaacctcaatctccggttggggtttcttctgatgagccgaagaagatt
gttgcgaccccaaatgcgaagaaattggcgaagcagcataaaattgatatcaataaagtg
aatgggactggcccatttggacggattatatcggaggatgttgagaaagctgctggaatt
actccagcaccgtccaagagtattagcccacctcctgctgctgctactgctgctgctccg
gcagtgggcacgccagcgaaagctgctccggttagtttaccggagattcctgggtcaaca
gttgttccgttcacaacaatgcaagttgcagtgtccaagaatatgatggagagtctctct
gttccaacatttcgtgttgggtatccagttattactgatgcccttgatgatttataccta
aaggtcaagaagaagggtgttacaatgaccgcattgttggccaaagctgcggcaatggca
ctagctcaacatccagttgtgaattcttcttgtaaagatggaaagagctttacgtacaac
agcagtataaatattgctgttgcggtggccattaacggtgggttgataacaccggtgctt
caggatgctgacaagttggatctgtatctgttgtctcaaaagtggaaggaactggtagag
aaggctagggctaagcaactacaaccacatgagtacaattcagggactttcaccttgtcc
aacttgggcatgtttggtgtggaccgatttgatgctattcttcctcctggccagggggct
ataatggctgttggagcatcaaaaccaactcctgtagctaatgctgatgggttcttcagc
gtcaaaaataagatgctggtaaacgtcacagcagatcaccgagttgtatatggcgcggac
ttagcagccttccttcaaacgttttccaagattattgagaatccagatagcttgacaatg
tag

DBGET integrated database retrieval system