KEGG   Solanum tuberosum (potato): 102593159Help
Entry
102593159         CDS       T02981                                 

Definition
(RefSeq) delta(12)-acyl-lipid-desaturase-like
  KO
K10256  omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.6 1.14.19.22]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot01040  Biosynthesis of unsaturated fatty acids
sot01100  Metabolic pathways
sot01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102593159
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sot01004]
    102593159
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     102593159
    1.14.19.22  acyl-lipid omega-6 desaturase (cytochrome b5)
     102593159
Lipid biosynthesis proteins [BR:sot01004]
 Desaturase
  Omega
   102593159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474
Motif
Other DBs
NCBI-GeneID: 102593159
NCBI-ProteinID: XP_006354202
UniProt: M1D5H1
LinkDB All DBs
Position
Un
AA seq 383 aa AA seqDB search
MGAGGRMSAPNGETEVKKNPLQKVPTSKPPFTVGDIKKAIPPHCFKRSLIRSFSYVVYDL
ILVSIMYYVANTYFHLLPSPYCYIAWPIYWICQGCVCTGVWVNAHECGHHAFSDYQWVDD
TVGLILHSALLVPYFSWKYSHRRHHSNTGSLERDEVFVPKPKSQLGWYSKYLNNPPGRVL
SLTITLTLGWPLYLAFNVSGRPYDRFACHYDPYGPIYNNRERLQIFVSDAGVLGVCYLLY
RVALVKGLAWLVCIYGVPLLVVNGFLVLITYLQHTHPSLPHYDSTEWDWLRGALATCDRD
YGVLNKVFHNITDTHVVHHLFSTMPHYNAMEATKAVKPLLGDYYQFDGTPIFKAMWREAK
ECLYVEKDESSQGKGVFWYKNKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggagctggtggtcgtatgtctgctccaaatggcgagactgaagtaaagaagaatcct
cttcaaaaggtaccaacctcgaaacccccttttacagttggtgatatcaagaaggctatc
ccacctcactgctttaaaaggtctctcatccgctcattctcctatgttgtgtatgacctc
atactcgtctccatcatgtactacgttgcaaacacttacttccacctccttccatctcca
tattgctacattgcgtggcctatttactggatttgccagggttgtgtttgcactggtgtt
tgggttaatgcccacgaatgtggccatcacgctttcagtgattaccaatgggttgatgac
accgttggacttatccttcactctgctctattggtgccgtacttctcttggaaatatagt
catcgtcgccaccactccaacactggctccctcgagcgtgatgaggtctttgtgcctaag
ccaaaatcccagcttggatggtattccaagtacttgaacaatccaccaggcagggttctc
tctcttacaatcaccctcactcttggctggccgttgtacttggccttcaatgtatctggc
agaccatacgaccgatttgcatgtcactatgacccttatggcccaatctacaacaaccgc
gagaggctacagatcttcgtttctgatgctggagttctcggagtttgttatctgctatac
cgtgttgccttagtgaaaggtctagcttggctagtgtgcatctacggtgtacccctcctt
gtcgtgaacggcttccttgtcctgatcacctacttgcagcacactcacccatcattgcct
cactacgattcaaccgagtgggattggcttaggggagctttggcaacctgtgacagagac
tatggggttctaaacaaggtcttccacaacatcaccgacactcacgtggtgcaccatctg
ttctcaaccatgccacactacaacgcgatggaggcaaccaaagcagtcaagccactactc
ggagactactaccaattcgatggaaccccaattttcaaggcaatgtggagggaagctaaa
gagtgtctctacgtcgagaaagacgaatcatctcaaggcaaaggtgtcttctggtacaaa
aacaagctctga

DBGET integrated database retrieval system