KEGG   Solanum tuberosum (potato): 102593496Help
Entry
102593496         CDS       T02981                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00061  Fatty acid biosynthesis
sot00780  Biotin metabolism
sot01100  Metabolic pathways
sot01212  Fatty acid metabolism
Module
sot_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102593496
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    102593496
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    102593496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sot01004]
    102593496
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     102593496
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     102593496
Lipid biosynthesis proteins [BR:sot01004]
 Fatty acid synthase
  Component type
   102593496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 102593496
NCBI-ProteinID: XP_006354203
UniProt: M1D593
LinkDB All DBs
Position
Un
AA seq 392 aa AA seqDB search
MAASAASSFQITIARPSVLSTRRISSFCSTKFGGETQKLSCNRLASSCHVSSIQHFWRSF
TSTTQKLQKVVTKAKSEADDSKPASVLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGA
EILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDSLEDVPEDIKTN
KRYAGSSKWTVSEVAESVKEDFGSIDILVHSLANGPEVTKPLLETSRRGYLAAISASSYS
YVSLLKHFLPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQK
VRVNTISAGPLRSRAAKAIGFIDMMIDYSIANAPLQRELSADEVGNTAAFLASPLASAIT
GAVIYVDNGLNAMGVGVDSPIFKDLNIPKSTE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatctgcagcttcaagctttcaaataacaatagctaggccatccgtactctct
actagaagaatttccagtttctgctcaacaaagtttggtggtgaaactcaaaaactgtcc
tgtaacagacttgccagtagttgtcatgtttcatccattcaacatttttggcgcagtttc
acatctacgactcaaaagttacagaaagttgtcaccaaggcaaaatcagaagctgatgat
agcaagcctgcctctgtgttgccgattgatttgagaggaaaaagggcttttatagctggt
atagctgatgataatggatatgggtgggctattgctaagtccctggctgctgcaggtgcc
gaaattctagttggaacctgggtgccagccttaaacatttttgaaacaagtcttcgacgt
gggaaatttgatgaatcacgcgttttgccagatggctctttgatggagattactaaagta
taccccctcgatgctgtttttgatagtcttgaggatgtacctgaagatataaaaacaaat
aagcgttatgctggttcttctaagtggacagtctcggaagttgcagaatctgtgaaggag
gattttggcagcatcgacattcttgtccattcacttgccaatgggccagaggtgactaaa
cctcttttggagacatcaaggagaggataccttgcagcaatatcagcatcaagttattcc
tatgtatctttgctaaagcatttccttccaattatgaacccaggtggttcttcgatttct
ctgacctatattgcgtcggagaggatcattccaggatatggagggggaatgagttctgcc
aaagcagcacttgagagtgacaccagagtacttgctttcgaggctggaagaaaacagaaa
gttagggtgaacacaatatctgctggccctttacgaagtcgagctgcaaaagcaattggt
ttcatagatatgatgattgactactccatagccaacgcacctctgcagagagaattatca
gcagatgaagtagggaatacagctgcattcctagcatcaccactcgcttcagcaattact
ggtgctgttatatatgttgacaatggtttgaatgcaatgggcgtgggagtcgacagtcct
atatttaaagacctcaacattcccaagagcacggaatag

DBGET integrated database retrieval system