KEGG   Solanum tuberosum (potato): 102601278Help
Entry
102601278         CDS       T02981                                 

Definition
(RefSeq) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00270  Cysteine and methionine metabolism
sot00450  Selenocompound metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102601278
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102601278
Enzymes [BR:sot01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     102601278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 102601278
NCBI-ProteinID: XP_006352296
LinkDB All DBs
Position
Un
AA seq 409 aa AA seqDB search
MKHHLILEDPAAALANVRHEFGEHGGVNMSIEASITFTVMEPENLSRMFAGELGPDRDFF
IYSRHLNPTVLNLSRLMAALEGTEAAYCTSSGMSAISSVLLQLCSSGDHIVASRSLYGGT
YALLTHFLPKACNITTSFVDIRDLNMVEEAIVEGRTKVLYFESISNPTLMVTDIPALCRI
AHSKGVFVVVDNTFAPMVLSPARLGADVVVHSISKYISGAADVIAGAVCGPASLINSMMD
LREGSLMLLGPTMNAKIAFELSERLPHLGLRMKEHSNRALVFATRITKLGLKVIYPGLEN
HPDHGLLKSLANEDYGYGGILCVDMETEEKANCLMNVLQNCTQFGLIAVSLGYYETLMSC
SGNSTSSEMNNQEKELAGISPGLVRMSIGYNGTLEQKWSQLEKALSQMQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccacctcatattggaggatccagcggcggcgttagcaaatgtccgccacgaa
ttcggcgagcacggcggcgttaacatgtccatcgaagcctccatcaccttcaccgtcatg
gagccggagaatttaagccgcatgttcgccggcgaactcggacctgaccgcgatttcttc
atctacagccgtcacttaaatccaacagtcctcaatttgagccggcttatggcggctctc
gagggcaccgaggctgcttactgcacatcctctggcatgtcggcgatatcatcggtgctg
ctccagctttgcagttccggcgatcacatcgttgcttcccgttcgttgtacggcgggaca
tatgctttgctcacgcattttttgccaaaggcgtgtaatataacgacgtcgtttgtggat
attagggatttgaatatggttgaggaagcaattgtggaagggagaacgaaggtgttgtac
tttgaatcaatttctaatccgacgttgatggttaccgatattccggcgttgtgcaggata
gcgcatagtaagggagtatttgtagtggtggataatacatttgctccgatggtattgtcc
ccggcgagattgggcgctgatgtggttgttcatagtatttccaaatatattagtggggct
gccgatgttattgcaggtgcagtttgtggaccggcaagtctgattaactccatgatggat
cttcgtgaagggtcacttatgctactaggcccaaccatgaatgctaagatcgcgttcgag
ctttcagagagacttcctcacttgggcttaagaatgaaagagcatagtaatcgagctctt
gttttcgctactagaataaccaagcttgggctcaaagtcatttacccaggcctagaaaac
catccagatcatggccttctcaagtccctagccaatgaagactatggctatggggggatt
ttgtgtgttgacatggaaactgaagaaaaggctaattgtttaatgaatgttttacaaaat
tgtactcaatttgggcttattgcagtgagtttgggttattatgagacactcatgtcatgt
tcgggcaatagcacaagtagtgaaatgaacaatcaagagaaggagttggctgggatttca
cctggattagtgagaatgtcaattggctataatggtacattggagcaaaaatggagccaa
cttgagaaagcattgtcacaaatgcaatag

DBGET integrated database retrieval system