KEGG   Solanum tuberosum (potato): 102602218Help
Entry
102602218         CDS       T02981                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00040  Pentose and glucuronate interconversions
sot00051  Fructose and mannose metabolism
sot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102602218
   00051 Fructose and mannose metabolism
    102602218
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102602218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_3 Pyr_redox_2 UDPG_MGDP_dh_N TrkA_N AlaDh_PNT_C DAO
Motif
Other DBs
NCBI-GeneID: 102602218
NCBI-ProteinID: XP_006340526
UniProt: M1CDC1
LinkDB All DBs
Position
Un
AA seq 355 aa AA seqDB search
MADEVEEENLAVWLLAIKTLRIQPFSLPSLGPYDVKIRIKAVGICGSDIHHFKNMRVANF
VVKKPMVLGHECAGIVEQVGSQVKFLMIGDRVALEPGISCRQCQLCKDGRYNLCRKMKFF
GSPPTNGALANQVVHPADLCFKLPDNVSLEEGAICEPLSVGVHACRRANVGPDTKLIIIG
AGPIGLVTMLAARAFGSPKIVIVDVDDCRLSFAKDLGADEIIKVSSIMQDVEEEVVRIRN
AMGGPVDLSFDCVGFNKTMTTALQATRTGGKVCLVGLGQSEMTLPLTSAAAREVDVIGIF
RYRNTWPLCIELLRTGEIDVKPLITHRYNFTQEGVDEAFETSSRGGNAIKVMFNL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaagtagaagaagagaacttggcagtttggcttcttgctatcaaaacactt
cggattcagccctttagtctcccatctcttggtccttatgatgtcaagattcgaattaaa
gctgttggtatatgtggaagtgatatccatcactttaagaatatgagagtagctaatttc
gtggttaaaaagccaatggtacttggccatgagtgtgctggaattgtagaacaagttggt
agccaagtgaagtttctgatgatcggtgatcgtgtagctttggaacctggtattagttgc
aggcagtgtcaactatgcaaagacggtcgctacaatctctgccgtaaaatgaagttcttt
ggctctcctccaacaaatggtgctttagccaaccaggtggtgcatcctgcagatctatgt
tttaagttacctgataatgtaagcttggaggaaggtgcaatatgtgaacctttgagtgtt
ggtgtccatgcttgccgccgtgccaatgtaggtcctgacaccaaactaatcatcataggt
gcgggacctattggcctggtcactatgctggcagctcgtgcttttggatcacccaagata
gtcatcgttgatgtggatgattgtcgtttatctttcgcgaaagacctgggtgctgatgag
atcattaaagtttcttccattatgcaggatgtggaggaggaagtggtgcgaatacgtaat
gcaatgggtggtccagtggatttgagctttgattgtgttggttttaacaagactatgaca
acggctctacaagccacccgcactggtggtaaagtatgcctcgttggattaggccagagt
gagatgactctccctcttacttcagctgctgcaagggaggtggatgtcataggcattttc
agataccgaaatacatggccgctctgcattgaacttctgagaactggggaaatagatgtg
aagcctctcataacccacaggtataactttactcaagagggtgtggatgaagcatttgag
accagttctcgcggcggaaatgccatcaaggtcatgttcaacctgtag

DBGET integrated database retrieval system