KEGG   Solanum tuberosum (potato): 102603887Help
Entry
102603887         CDS       T02981                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03030  DNA replication
sot03410  Base excision repair
sot03420  Nucleotide excision repair
sot03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102603887
   03410 Base excision repair
    102603887
   03420 Nucleotide excision repair
    102603887
   03430 Mismatch repair
    102603887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sot03032]
    102603887
   03400 DNA repair and recombination proteins [BR:sot03400]
    102603887
Enzymes [BR:sot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102603887
    6.5.1.6  DNA ligase (ATP or NAD+)
     102603887
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102603887
DNA replication proteins [BR:sot03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102603887
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102603887
DNA repair and recombination proteins [BR:sot03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102603887
   NER (nucleotide excision repair)
    Other NER factors
     102603887
   MMR (mismatch excision repair)
    Other MMR factors
     102603887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 102603887
NCBI-ProteinID: XP_006357803
LinkDB All DBs
Position
Un
AA seq 1441 aa AA seqDB search
MSSAAGTLTLDSITLYITALNSLSDKSSSNSIPLSLPLSPIPSSIPQPKLIPRTRFIIDG
FKYAADFSVSYFLSHFHSDHYTGLSSNWSKGIIFCSSTTANLLIQVLNVPAQYVVSLPLS
EAVLIDGSEVYLIDANHCPGAVQFLFKVPVSDGKFERYVHTGDFRYCDDMKLEPVLNAFV
GADAVFLDTTYCHPKFIFPSQQESIDYIVGVIEKSGAENEGSLKNILFLIATYVIGKEKI
LIEVSRRCQRKIHVDGRKMSVLGVLGHGEDGVFTTVESETDVHVVGWNVLGETWPYFRPN
FEKMDKIMNEKGYSKVVGFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELREY
VKFLKPKHVIPTVGTDVEKLDSKHANAMRKHFAGLVDEMAIKQEFLMGFHRSVQGKEDVD
AKASGLALVSITEQENTNRSAHTLVSIIKQKNEDTSSDSISCNAADMNTVIHSSFPQGES
VSPGLEKISEGDMEEILEELQGCLPTWVTKGQMLDLLSISDKNVVDAVSYFYEHETEYRE
QVTASNSVTSSFEANSANESALPSKPCLGKTPQQGETTASSKTVKLPIMDSSSSKKVSPG
KRKRSTGNKSSSSSKKVSPGNRKRSTGNKSFEKAKGHASMDSGGPKQCTITKFFSKTLPL
SLQNGNSKADSKNFHDDNCMPPNASIEAYKEEADRFIQIMNGDDSLRSYATTVLAKTKGD
ISMALDIYFSEYKDVGETNGDGISKTNKLLQPQCAKEVYPSSKDDKLPKILGDDDADLSL
CGVPFADNAVNYVSLPHEKYSPVEHACWSKGQAAPYIHLARTFELVKEEKGKIKATSMLC
NMFRSLLALSPEDVLPAVYLCTNKIAPDHENMELNIGGSTVVAALEEACGTKKSKVRELY
NSLGDLGDVAQLCRQTQSLLAPPVALTVRGVYSALRRISLQAGSGSAIRKKSLIVNLMCS
CREKEMKFLVRTLVRNLRIGAMMRTVLPALAQAVVFNSTPYEGLVENLKDCLQRLSAEVV
EAYNILPSLDVLVPSLMEKGIEFSSNTLSMAPGIPIKPMLAKITNGVPQVMKLFHNKAFT
CEYKYDGQRAQIHKLSDGSVRVFSRNGDETTSRFPDLVNIITESCDSRGATFILDAEVVA
IDRQNGPKLMSFQELSSRERGSKDSIIALDKIKVEICIFVFDIMFANGEQLLNLPLRQRR
KYLKDLFGDGKVGYLEYATEMTVECDDACADDEATLARMNSFLNAALHASCEGIMVKSLD
EDAGYTPSKRSDAWLKVKRDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPDTE
EFQSVCRVMSGFSDSFYVEMRDFFDADKICQKKPPYYRSEEVPDMWFSPEVVWVIRGADF
TVSPVHHAAIGLVHPSRGISVRFPRFIRCVSDRKPEECSTSADIADMFRSQIRKMDVKAE
K
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccgccggaaccctaaccctcgactcaatcactctgtacataaccgctctc
aactccctctccgacaaatcctcatcaaattcaatcccattatccctccctctctcccca
atcccttcttcaatccctcaaccgaaactcatcccaagaactcgttttatcatagacggt
ttcaaatatgccgccgatttctccgtttcttacttcctctcccattttcactccgatcac
tatactggcctgtcctctaattggtctaaaggtatcatattctgttcctccaccactgct
aaccttctcatccaagttctcaatgttcccgcgcaatatgtagtgtctttaccgctttcc
gaagcggttttaattgacggttctgaagtttatctcatcgatgccaatcattgtcctggt
gctgtgcaattcttatttaaagttccagttagtgatggaaagtttgagcggtacgttcac
acaggtgattttcgttattgtgatgacatgaaattagagcctgtattgaatgcatttgtg
ggtgctgatgctgtatttttggatacaacttattgtcatccgaaatttatattccctagt
caacaggaatcaattgattatatagttggagttatagagaaaagtggagctgagaatgag
ggttcattgaaaaatatcttgtttcttattgctacttatgttattgggaaagagaagatt
ttaatagaggtttcgcggaggtgtcagagaaagatccacgttgatggcagaaaaatgtcg
gttttaggagtattaggtcatggggaggatggggtgtttacgactgttgaatctgaaact
gatgttcatgttgttgggtggaatgtattgggtgagacttggccatatttcagacctaat
tttgagaaaatggataagatcatgaatgagaaaggatattccaaggtggttggttttgtc
cccacaggttggacttacgaagtgaagcggaataagttttcagtgagaaagaaagattcc
tttgagatacatcttgttccgtatagtgaacattcaaattatgacgagcttagagaatat
gttaagtttttgaaaccaaagcatgtcatcccaacagtaggtacagatgttgagaagctg
gatagcaaacatgcaaatgccatgcggaagcattttgctggcttggttgatgagatggcc
atcaagcaagaattcttaatgggttttcatcgttctgtccaagggaaggaggatgtagat
gcaaaagcatcgggtcttgctttagttagtatcaccgagcaagaaaacacaaacagatct
gctcatactttagtcagtatcatcaagcaaaaaaatgaggatacttcatcagattctata
agctgcaatgctgctgatatgaatactgttatccattcctcatttcctcaaggagaatct
gtgtcgccaggtttagaaaaaataagtgaaggtgatatggaggaaatactagaagaactt
caaggctgtttgcccacttgggtaactaaaggtcagatgttggatttacttagtatttcg
gataaaaatgttgttgatgcagtctcatacttttacgaacatgaaacagaatatcgtgaa
caggtcactgccagtaattctgttacctcttcttttgaggcaaactcagcaaatgagtct
gcattaccttccaaaccatgtcttggtaaaaccccgcagcagggtgagacaactgcatca
agtaaaactgttaaactacccatcatggacagttccagtagcaaaaaagtttctcctggt
aaaaggaagagaagtactggaaacaagtccagttccagtagcaaaaaagtttctcctggt
aacaggaagagaagtactggaaacaagtcatttgagaaagcaaaaggacatgcgagtatg
gattctggtggaccaaagcaatgtactataacaaagttcttcagtaaaacgcttcctctt
tctttgcagaatggaaacagtaaagctgatagtaaaaatttccatgatgataactgcatg
ccaccaaatgcctctattgaggcttataaagaggaagctgatcggtttattcagattatg
aatggggatgactctttgagaagttatgctaccacagtactagcgaagactaaaggagac
ataagtatggcacttgatatttatttttcagaatacaaagatgtaggagagactaatgga
gatgggatttctaaaacaaacaaattgttgcaacctcagtgtgctaaagaggtttaccct
tcttccaaagatgataaattacccaaaatattaggagatgatgatgccgatttgtcgtta
tgtggtgttccctttgctgataatgctgtaaattatgtatcacttccccatgagaaatac
tctcccgtggagcatgcttgctggagtaaggggcaggctgctccatacatacatcttgca
cgaacttttgaattggtaaaggaagaaaaagggaagataaaagcaacatcaatgttgtgc
aatatgtttcggagcttgctagccttgtctccggaggatgtgcttcctgcagtgtacttg
tgcacaaacaagatagcccctgatcatgaaaatatggaattgaacattgggggtagtact
gttgtagcagcactagaggaggcatgcgggacaaagaaatcaaaagtacgagaactatac
aacagtctcggtgatcttggtgatgttgctcaactttgccgacaaacacaatcattactt
gctcctccagtggcacttacagttaggggtgtatactctgctcttagaaggataagcttg
caagcaggtagtgggagcgccatccgaaagaaaagcctgattgtcaatctcatgtgttca
tgtagagagaaggagatgaagtttcttgtgagaactttggttcggaatttgcgcattgga
gccatgatgagaactgttcttcctgcattagctcaagcagttgtgttcaattctactcct
tatgaaggactggtcgaaaacctgaaagattgtctgcagcgtctttcagcagaagtagta
gaagcgtataacatccttcccagcttggatgtacttgttccttccttgatggagaagggg
attgagttttcttcaaatacattgtcaatggctccaggcatacccatcaaaccaatgctt
gcaaagattactaatggggtccctcaagtgatgaaactctttcacaacaaagcctttaca
tgtgaatacaaatatgatggtcagcgagctcaaattcataaactgtctgatggttcagtc
cgtgtattttcaaggaatggggatgaaacaacatctagatttccggatttggtcaacata
attacagaatcatgtgattccagaggagcaacatttatcttggatgcagaggttgttgca
attgatagacaaaatggtccaaagctcatgtcgttccaagaactatcttcacgtgagagg
gggtccaaagattccatcattgcgttagataaaattaaggttgagatatgcatttttgtt
ttcgatatcatgtttgcaaacggagaacaattgttgaatctgccgctccgtcaaaggcga
aaatatttgaaggatttatttggtgacggcaaagtaggttatttagagtacgcgacagaa
atgactgtagagtgcgatgatgcttgtgcagatgatgaagccacactggctaggatgaac
agctttcttaatgctgcactacatgcttcatgtgaagggatcatggtgaagtctcttgat
gaagatgctgggtacacaccatcaaagcgctctgatgcatggttaaaggtcaagagagac
tatgttgaaggattaaatgattccctggacttggttccaattggtgcttggcatgggaat
ggaagaaaagcaggatggtatagtcctttccttatggcctgctacaaccctgacacagag
gaatttcagagtgtctgccgggtcatgtctgggttttctgattccttctatgtagagatg
agagacttcttcgatgcggacaagatctgccagaaaaagccaccctactaccgaagtgaa
gaagttccggatatgtggttttctccagaagttgtgtgggtgataaggggtgctgacttc
acagtgtcaccagtgcatcacgcagccattggtttagtccatccatctcgtggtatttct
gtcagattccccagattcatacggtgtgtgtcagatagaaaacctgaggaatgtagcaca
tctgctgatatagctgacatgttccgctctcagattagaaaaatggatgtgaaggctgaa
aaatag

DBGET integrated database retrieval system