KEGG   Solanum tuberosum (potato): 102604123Help
Entry
102604123         CDS       T02981                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00020  Citrate cycle (TCA cycle)
sot00190  Oxidative phosphorylation
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
sot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102604123
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102604123
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102604123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 102604123
NCBI-ProteinID: XP_006340609
UniProt: M1B744
LinkDB All DBs
Position
Un
AA seq 630 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGGHFRRLFSSQTNVGGSSYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAANTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVTKKGDDPDAVIPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEEQKPLEKDAGERTIA
WLDKIRNSNGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDR
GLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTIGFWE
DEKVRLEYRPVHMNTLDDEVESFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtgtcgcgtggtcttcgcgcttcctccaacagatctatctccggcggc
ggcggccattttcgccgactcttctcctcacaaactaatgtgggaggctcgtcctacacg
atagtggatcacacatacgatgcggtggtggtcggtgcaggcggtgctgggcttcgtgca
gcaatagggttgtctgagcatggattcaatactgcttgcataaccaagctctttcctact
cgatctcacactgttgcagctcagggtggtataaatgctgcattaggcaacatgacagaa
gacgattggaggtggcacatgtatgatacagtcaaaggaagtgattggttaggtgatcag
gatgctatccaatacatgtgtagagaagcaccaaaagcagttatagagcttgagaattat
ggtttgcctttctctcgaacagaagatggtaaaatatatcaacgtgcatttggtggtcaa
agcctggactttggaaaaggaggacaagcctatcgttgtgcatgtgctgcggatcggact
gggcatgctctattgcatactctttatggccaggccatgaagcataatacacagtttttt
gtggaatatttcgctttggatttactaatgaacagtgatgggagctgccaaggtgtaata
gcactaaatatggaggatggcaccttgcatcgattccgtgctgccaatacaattttggcc
accgggggttatggccgagcttacttctcggcaacatctgctcatacttgcaccggagat
ggtaatgctatggttgcgcgcgctgggcttcctcttcaggatcttgagtttgtgcaattt
catccaactggtatatatggagctggttgcctcattactgaaggatctcgcggtgaaggt
ggtatcctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaactgccaag
gatcttgcgtcaagagatgttgtttccagatctatgactatggaaattcgagaagggcgt
ggtgtaggacctttgaaggaccatatctatcttcacctcaatcacttacctccagaggtt
cttaaggagagacttccgggtatctctgaaacagctgccattttcgctggtgttgatgtg
actaaggagccaattcctgttttacctaccgtgcattataatatgggaggaatcccaact
aattaccatggacaggtggtcactaaaaaaggggatgatccagatgctgtgatccctgga
ctgatggctgctggtgaagcagcatgtgcatctgttcatggtgccaatcgtcttggtgca
aattctcttctagatattgttgtttttggacgggcatgtgctaatagggttgcagagatc
caaaaaccaggtgaggaacagaagccacttgaaaaggatgctggagagaggaccatcgca
tggttggacaagattaggaactcaaatggttcattgcccacctcaaatataaggctgaac
atgcaaagagttatgcaaaacaatgctgctgtcttccgcacacaagagacattagaggaa
ggttgccagctcattgacaaaacatgggagagtttccatgatgttcagttgaaggacaga
ggtttaatatggaacacagatcttatagagactattgagttggaaaaccttttaattaat
gcatgcatcaccatgcactcagccgaggcaagaaaagaaagcagaggagctcatgctcgt
gaagattttacgaaaagagatgatgagaagtggatgaaacataccataggattttgggaa
gacgagaaagttcggctagaatacagaccagtgcatatgaacactctagatgacgaagtc
gagtcgttcccaccaaaggctcgtgtctactga

DBGET integrated database retrieval system