KEGG   Solanum tuberosum (potato): 102604298Help
Entry
102604298         CDS       T02981                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot03030  DNA replication
sot03410  Base excision repair
sot03420  Nucleotide excision repair
sot03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sot00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102604298
   03410 Base excision repair
    102604298
   03420 Nucleotide excision repair
    102604298
   03430 Mismatch repair
    102604298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sot03032]
    102604298
   03400 DNA repair and recombination proteins [BR:sot03400]
    102604298
Enzymes [BR:sot01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102604298
    6.5.1.6  DNA ligase (ATP or NAD+)
     102604298
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102604298
DNA replication proteins [BR:sot03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102604298
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102604298
DNA repair and recombination proteins [BR:sot03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102604298
   NER (nucleotide excision repair)
    Other NER factors
     102604298
   MMR (mismatch exicision repair)
    Other MMR factors
     102604298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 102604298
NCBI-ProteinID: XP_006349032
LinkDB All DBs
Position
Un
AA seq 802 aa AA seqDB search
MLCLSSYRFTQTTLLYNFSLKPSSSIFLHFSKKKQFPLKPLFFSVNPNSRTMSDSPPTPP
PPRSAFAVLMANSKKKTTSSPKKRKTPDVETSSKSPVVNQDSVLMPIKDTHLVNESKSEE
VVVKKRNQDSILKPIEDTHLVNESKSEECVVKKRKMISPDESIVEIKKKAANFDPKKAVY
WGDGQRVPFMFVVKAFDAISKESGRIVITEIVTNMLRTVIETTPEDLLPVVYLAANKIAA
AHDGMELGIGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMHKPEALT
VAKVFDTFRIIAKESGKDSQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLL
VAIAHAFVYSDKHSSPPAGVDSPLEEAAKIVKQVFSVIPVYEKIVPALLADGVWKLSETC
GFSPGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAE
RNTGKFPDVVTAISRLKKSSATSFVLDCELVAYDREKQKILPFQVLTTRARKNVVISEIK
VNVCIYAFDILYLNGQPLLQEQLNVRREHLYKSFEEEPGYFQFATAVASNDLEEITKFLE
DAVNGSCEGLIIKTLTKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIGAFHGRGKRT
GVYGAFLLACYDSNNEEFQSICKIGTGFSEVELEERSSSLRSKVIPKPKSYYRYAETINP
DVWFEPTEVWEVKAADLTISPVHRAAQGIVDPEKGISLRFPRLSRVREDKKPEEASSADM
VADMYNAQKHNQKSNQDGNDED
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtttgagttcatatcgtttcactcaaaccactcttctttacaatttctccctt
aaaccttcttcttcaatctttcttcacttctccaagaagaagcaattccctctcaaaccc
cttttcttctctgtaaaccctaattcaagaaccatgtctgattctcctcctactcctcct
cctcctcgctctgcgtttgctgtccttatggcaaattccaagaagaaaacaacctcctca
cccaagaaacgtaaaaccccagatgttgaaacttcaagtaaaagccctgttgttaatcaa
gattcagttttgatgccaattaaggacacccatttggtcaatgagtcgaaaagtgaggag
gtggtggtgaagaaacggaatcaagattcaattttgaagccaattgaggacacccatttg
gttaatgagtcgaaaagtgaggagtgtgtggtgaagaaacggaaaatgattagtccagat
gagagcattgtggaaataaagaaaaaagctgcaaattttgatccaaaaaaggctgtatat
tggggggatgggcagagagtgccgttcatgtttgtagttaaggcgtttgatgcaatttcg
aaggagtcagggaggattgttattactgagattgtgactaatatgttgaggactgtgatt
gagacgacgcctgaggatttgttgcctgttgtgtaccttgctgctaacaagattgcagct
gcacacgatgggatggagcttggtattggtgatgcttccattatcaaggcacttgctgaa
gcctgtggtgctaaagaagcacatatcaagaagcaatacaaggagcttggagatttgggc
cttgttgcaaaagcaagtcgttcatcacagcctctgatgcataaaccagaagcactgact
gttgccaaagtttttgacacatttcgaatcattgccaaggaatctggaaaggatagtcag
gaaaagaaaaagaattacattaaatcactgcttgttgcagccactgattgtgaaccccaa
tatttgattcgtcttctccagacaaagctacgcattggtttggctgaacaaacactgtta
gtcgcaatcgctcatgcttttgtgtactcagataagcattcatcacctcctgcaggtgta
gattctcctttggaagaggccgccaagattgtaaagcaagtgttctctgtgattccagtt
tatgaaaaaattgtccctgctcttctagctgatggtgtttggaagctttcagaaacatgt
ggtttctcacctggtgttccggttggacctatgctagctaagccaaccaaaggagtatct
gaaattcttgataagtttcaggatatggagttcacatgtgaatacaagtatgatggtgaa
cgtgctcagatacactacatggaagatggttctgttgagatatatagccgaaatgcagaa
agaaatactggaaagtttcctgatgttgttactgctatctcaagattgaagaaatcttct
gcaacttcatttgttcttgactgtgaactggttgcatacgaccgtgagaaacagaagatc
ctgccctttcaggtccttactacacgtgctcgtaaaaatgttgtcattagtgaaatcaag
gtcaacgtgtgcatatatgcttttgatatcttgtatcttaatggacagccacttcttcaa
gagcaacttaatgttcgcagagagcatctttacaagtcatttgaagaagaacctggatat
ttccagtttgctacagctgtagcctcaaacgatcttgaggaaataacaaaatttcttgaa
gatgcggtcaacggcagttgtgagggattgattatcaaaacactaactaaagatgctaca
tatgagccttcaaaacggtcaaataactggctaaaactgaagaaggattacatggagagt
attggcgactcactggatctggtaccaattggtgcttttcatggtcgggggaaacgtact
ggtgtttatggagcctttctcctagcttgttatgatagcaacaacgaggagtttcagagc
atctgtaaaatcggaactggattttctgaagtagagcttgaggaacgctcttccagcctt
cgttctaaagttattcctaaaccaaagtcatattacaggtatgctgaaaccatcaatcca
gatgtatggtttgaacctactgaggtctgggaagtgaaagctgctgatcttactatcagc
cctgtccaccgtgctgcccaaggtatcgtggatcccgagaagggaatttcattacgattt
ccccgtctgagccgtgtacgagaagacaagaagcctgaggaggcctcatcagcagatatg
gtagcggatatgtataacgctcagaaacacaatcaaaaaagcaatcaggatggcaatgat
gaagactaa

DBGET integrated database retrieval system