KEGG   Solanum tuberosum (potato): 102605737Help
Entry
102605737         CDS       T02981                                 

Gene name
RBCS-C, RBCS-3, rbcS3
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain C, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00630  Glyoxylate and dicarboxylate metabolism
sot00710  Carbon fixation in photosynthetic organisms
sot01100  Metabolic pathways
sot01200  Carbon metabolism
Module
sot_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sot_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sot_M00532  Photorespiration
sot_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    102605737 (RBCS-C)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102605737 (RBCS-C)
Enzymes [BR:sot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     102605737 (RBCS-C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 102605737
NCBI-ProteinID: NP_001275244
UniProt: P10647
LinkDB All DBs
Position
Un
AA seq 181 aa AA seqDB search
MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQ
VWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYY
DGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcaattgtctcctcagcagccgttgctacccgtagcaatgttgctcaagct
agcatggtcgcacccttcaccggactcaaatccgccgcgtctttccccgttactaagaag
aacaacaacgttgacattacttcccttgctagcaacggtggacgtgttagatgcatgcag
gtgtggccaccaattaacatgaagaaatacgagacattgtcataccttcctgacttgtcc
gatgagcaattgctcaaggaagttgagtaccttttgaaaaatggatgggttccttgcttg
gaattcgagactgagcacggatttgtgtaccgtgagcacaacagctcaccaggatactac
gatggtagatactggaccatgtggaagttgcctatgtttgggtgcactgacggaacccag
gtgttggctgaggttcaagaggccaagaatgcgtacccacaggcctggatccgtattatc
ggattcgacaacgttcgtcaagtgcagtgcatcagtttcattgcctacaagccagaagga
tactaa

DBGET integrated database retrieval system