KEGG   Solanum tuberosum (potato): 102605869Help
Entry
102605869         CDS       T02981                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sot00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102605869
Enzymes [BR:sot01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102605869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102605869
NCBI-ProteinID: XP_006349038
UniProt: M0ZHX4
LinkDB All DBs
Position
Un
AA seq 215 aa AA seqDB search
MAAHSIFTTTSTTNSFLYPISSSSPNINSSFHGVSLNVKSNFRQSLTLYAVNTPKPLTVF
AATKKAVAVLKGNSNVEGVVTLSQDDGGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMS
TGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEATLVDNQIPLTGPNSVVGRALVV
HELQDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccactcaatcttcaccacaaccagcactaccaattctttcttatacccaatt
tcttcttcttcccctaacattaactcttcttttcatggtgtttcactcaatgttaagtca
aattttcgccaatctttgaccctttatgctgtcaatactcccaaaccccttactgttttt
gctgctactaagaaagctgttgctgtccttaagggcaactctaatgttgagggggttgtc
actctatctcaagatgatggtggtccaactacggttaatgttcgtataactggacttgct
cctggacttcatgggtttcatttacatgaatatggtgacactacaaacgggtgtatgtct
acaggagcccatttcaatcccaataaattgacacatggagctcctggagatgaaatccgt
catgcgggtgacctgggaaacatagtggccaatgccgatggcgtggctgaagcaacactt
gtagataatcagataccattgaccggtccaaactcagttgttggacgagcacttgtagtt
catgagcttcaggatgacctcggaaagggtggccatgaactcagccttaccactggcaat
gctggtggacgattggcatgtggtgtggttggtttgactccaatatga

DBGET integrated database retrieval system