KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_0513Help
Entry
Spy49_0513        CDS       T00780                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00620  Pyruvate metabolism
soz00680  Methane metabolism
soz01100  Metabolic pathways
soz01120  Microbial metabolism in diverse environments
soz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:soz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spy49_0513 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Spy49_0513 (ppc)
Enzymes [BR:soz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Spy49_0513 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-ProteinID: ACI60841
UniProt: A0A0H3BZC8
LinkDB All DBs
Position
502311..505109
Genome map
AA seq 932 aa AA seqDB search
MIEETSKEGDGHLPLKKLESSNNQAIIAEEVALLKEMLGNITRRMIGDDAFTVIESIMVL
SEKQDYIELEKVIANISNQEMEVISRYFSILPLLINISEDVDLAYEINHQNNTDTDYLGK
LALTIKDLAGKDNGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGV
INLEKWRQELYRYIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLA
QKHGLELDNPKPITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTF
SLSSTLVQPNSEVERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSS
SVGLNTSAWPSPASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVD
IFGFFLASIDMRQDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLVQQLMEEPRTLSS
AAVAKSDLLEKELAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQ
QRARVQIVPLFETIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYL
ASGWTLYKAQNELTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLT
EQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNTIY
RKLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMF
PGWYGVGSAFKRYIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLA
ESQDVRDVFYEILDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIEL
IKRWRNNQLDENDEKLIHTTINGIATGLRNSG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagaaactagcaaagaaggagatggtcatttgccacttaaaaagttagagagt
agtaacaatcaagctatcattgctgaagaagttgctcttttgaaagaaatgttgggaaat
atcacacgacggatgattggagatgatgcgtttacagttatcgagtctattatggtgtta
tctgaaaaacaagattacatagaattagaaaaagttatcgccaatatttcaaatcaagaa
atggaagtgatttccaggtatttttctattttacccttgctaatcaatatttcagaagat
gtcgatttagcctatgaaattaatcatcaaaataatacggatactgattatttaggaaaa
ttagccctaaccatcaaggatcttgctggaaaagataatggtaaagacattttggagcag
gttaatgtggttcctgttttaacagcacatccgacgcaagtacaacgtaaaacgattctg
gaattgacaactcacattcataaacttctgcgcaaataccgtgatgctaaggctggtgtg
attaatcttgagaaatggcgtcaggagctatatcgttatattgaaatgatcatgcagaca
gatattattcgcgagaaaaagcttcaggtgaaaaacgagataaaaaatgtcatgcagtat
tacgatggttctctcattcaagcagtgaccaagttgacaacagagtacaaaaacttagcc
caaaaacacggtctagagttagacaatcccaaacccattaccatggggatgtggattggt
ggggaccgtgatggcaacccctttgtcacagctgaaaccttgtgcttgtcagctacggtt
caaagtgaggttatcctcaattactacattgacaaattagcagccctttaccgaacattt
tcactgtcgtcaaccttggtacaacccaactcggaagtggaacgtttagccagtttgtct
caggaccaatcgatttaccgtggaaatgaaccttatcgcagagcttttcattatattcaa
tcgcgtcttaaacaaacacaaattcaactaactaatcagccagcagctcgtatgagtagt
agtgtgggactaaacacatctgcttggccctcaccagctagtttagaaaatcccatctta
gcctatgactctcctgttgattttaaagctgatttaaaggctattgagcagtcgctactt
gataatggcaactccgctttgattgagggggatttgcgagaagtcatgcaagctgttgat
atttttggcttcttcttagcaagcattgacatgaggcaagactccagtgtccaagaagct
tgtgtggcagagttattaaaaggagccaatattgttgacgattatagctctctttcagaa
actgaaaaatgcgatgttctcgtacaacaattaatggaggagccaaggaccttatcctca
gcggcagttgctaaatcagacctattagaaaaagaactggctatctatactacggcacga
gaattgaaagataagcttggagaagaggttattaagcaacatattatttcacatacagaa
agtgtctctgatatgtttgagttggccatcatgcttaaagaagtgggattggttgaccag
cagcgggctcgtgtgcaaattgttcccctctttgaaaccattgaggatttagataatgcc
cgtgacatcatggcagcctatttaagccatgacattgtcaaatcttggattgcaacgaat
cgtaattaccaagaaatcatgttaggttattctgacagtaataaagatggtggctacttg
gcatcgggttggactctttataaagctcagaatgaattaacggctattggtgaggaacat
ggagtgaaaatcaccttcttccatggtcgtggaggaacagttggtcgaggaggtggccct
tcttatgatgccattacttcacaaccttttggttccatcaaagatcggattcgtctgaca
gagcaaggggaaattattgaaaacaaatacggcaataaagatgtggcttattaccattta
gaaatgttgatttcagcttctatcaatcgtatggtgactcaaatgataacagatcccaat
gagattgatagttttcgagaaatcatggatagcattgttgctgatagcaataccatttat
cgaaaattggtttttgacaatccccatttctatgattatttctttgaggcaagcccgatt
aaggaagtttccagtctcaacattgggtcaagaccagcagcccgtaaaacgattacggaa
attacaggcttgcgtgccattccttgggtcttttcatggtcacaaaatcgcatcatgttc
ccaggttggtatggggtaggttcagcctttaaacgttatattgaccgagcacaaggtaac
cttgaacgcctccaacacatgtatcagacgtggccttttttccattccttgttatcaaat
gttgatatggtattatctaaatcaaacatgaatattgcctttcagtatgcacaactagct
gaaagtcaggatgttcgagatgttttttatgagattttggatgagtggcaattgacaaaa
aatgttattcttgctatccaagaccatgatgatctattggaggataatccttcccttaag
catagcttgaagtcacgcttgccgtattttaatgtgttgaactatattcaaattgaattg
attaaacgttggcgtaataatcaacttgacgaaaatgatgaaaaattgatccatacaact
atcaatggcatagcgactggtttacgtaattcaggctaa

DBGET integrated database retrieval system