KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_0809Help
Entry
Spy49_0809        CDS       T00780                                 

Gene name
acoC
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Pathway
soz00010  Glycolysis / Gluconeogenesis
soz00020  Citrate cycle (TCA cycle)
soz00620  Pyruvate metabolism
soz01100  Metabolic pathways
soz01110  Biosynthesis of secondary metabolites
soz01120  Microbial metabolism in diverse environments
soz01130  Biosynthesis of antibiotics
soz01200  Carbon metabolism
Module
soz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:soz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spy49_0809 (acoC)
   00020 Citrate cycle (TCA cycle)
    Spy49_0809 (acoC)
   00620 Pyruvate metabolism
    Spy49_0809 (acoC)
Enzymes [BR:soz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Spy49_0809 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PLA2_B
Motif
Other DBs
NCBI-ProteinID: ACI61119
UniProt: A0A0H3C0D5
LinkDB All DBs
Position
803248..804657
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADVGPTVAPKENVASPAPQV
AATAIPQGNGGKVRATPAARKVAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVDLPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctgggcgttgacatgcaagaaggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatatccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgtgctattgaaaattgtc
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagagggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagatgttggaccaacagttgctccaaaagaaaatgtggcaagtccagctcctcaagtg
gcagcgacagctattccgcaaggaaatggcggaaaagttcgtgctactccagctgcacgt
aaggtagcagcagaaatgggcattgaccttggccaagttccaggaacaggaccaaaagga
cgtgtccataaagaagacgttgaaaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaattgcagcagacaaaggtattgatttggcaaccgtatcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagcggctaaaccagctgaa
gcaaaagccccagcagctaaagaagaaaaagttgttgatcttccagaaggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcccctacctttacgcttaactacgatattgacatgacagagatgattgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagctttacagacttgatt
ggtatggcagtggttaaaaccttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaatgatgctaatgatattgaattgcaccgctttgtgaaccttggtattgccgtaggt
cttgatgatggtcttatcgttcctgttatccatggggctgacaagatgagcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaggcagct
gaaatgtctggatcaaccttctctatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcgatgtgcctaaccatc
gaccaccgtttagttgatggtatgaacggtgcaaaattcatggttgatctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system