KEGG   Streptococcus pyogenes NZ131 (serotype M49): Spy49_1122cHelp
Entry
Spy49_1122c       CDS       T00780                                 

Gene name
sodM
Definition
(GenBank) Superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
soz  Streptococcus pyogenes NZ131 (serotype M49)
Brite
Enzymes [BR:soz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Spy49_1122c (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACI61413
UniProt: A0A0H3BYY9
LinkDB All DBs
Position
complement(1116524..1117168)
Genome map
AA seq 214 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTPDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVGEHAYYLNYRNVRPNY
IKAFFEIINWKKDQNFTKPLNKKRVSNLKKRLDF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaagccttaattaataatggtggcggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcactcctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcagggtgggcatggttagttgttaataaagaaggacaactc
gaaatcacttcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgggggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcattaattggaaaaaagatcagaactttaccaagccgcta
aataagaaaagggtttccaatctcaaaaagagattggatttttaa

DBGET integrated database retrieval system