KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy0529Help
Entry
M6_Spy0529        CDS       T00191                                 

Definition
(GenBank) Protein Translation Elongation Factor Tu
  KO
K02358  elongation factor Tu
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Brite
Translation factors [BR:spa03012]
 Eukaryotic Type
  Elongation factors
   M6_Spy0529
 Prokaryotic Type
   M6_Spy0529
Mitochondrial biogenesis [BR:spa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    M6_Spy0529
Exosome [BR:spa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   M6_Spy0529
  Exosomal proteins of breast cancer cells
   M6_Spy0529
  Exosomal proteins of colorectal cancer cells
   M6_Spy0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAT86664
UniProt: Q5XD49
LinkDB All DBs
Position
519982..521229
Genome map
AA seq 415 aa AA seqDB search
MAYRLSIKYILLEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSS
VNQPKDYASIDAAPEERERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMD
GAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSE
YDFPGDDLPVIQGSALKALEGDTKFEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVFS
ITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGILL
RGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVT
GSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccgtctatctataaaatatattttattggaggcttttcctaaaatggcaaaa
gaaaaatacgatcgtagtaaaccccacgttaacattggtacaatcggacacgttgaccat
ggtaaaactactttaacagctgcaatcacaactgtattggcacgtcgcttgccttcatca
gttaaccaaccaaaagattacgcttctatcgatgctgctccagaagaacgcgaacgcgga
atcactatcaacactgcacacgttgagtacgaaactgcaactcgtcactatgcgcacatc
gacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgctcaaatggac
ggagctatccttgtagttgcttcaacagatggaccaatgccacaaactcgtgagcacatc
cttctttcacgtcaagttggtgttaaacaccttatcgtcttcatgaacaaagttgacctt
gttgatgacgaagagttgcttgaattagttgagatggaaattcgtgaccttctttcagaa
tacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaagctcttgaa
ggcgacactaaatttgaagacatcatcatggaattgatggatactgttgattcatacatt
ccagaaccagaacgcgacactgacaaaccattgcttcttccagtcgaagatgtattctca
atcacaggtcgtggtacagttgcttcaggacgtatcgaccgtggtactgttcgtgtcaac
gacgaaatcgaaatcgttggtatcaaagaagaaactaaaaaagctgttgttactggtgtt
gaaatgttccgtaaacaacttgacgaaggtcttgcgggagacaacgtaggtatccttctt
cgtggtgttcaacgtgacgaaatcgaacgtggtcaagttattgctaaaccaggttcaatc
aacccacacactaaattcaaaggtgaagtatatatcctttctaaagacgaaggtggacgt
cacactccattcttcaacaactaccgtccacaattctacttccgtacaactgacgtaaca
ggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataacgtaacaatc
aacgttgagttgatccacccaatcgccgtagaacaaggtactactttctcaattcgtgaa
ggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system