KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1381Help
Entry
M6_Spy1381        CDS       T00191                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Brite
KEGG Orthology (KO) [BR:spa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spa01001]
    M6_Spy1381
Enzymes [BR:spa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M6_Spy1381
Protein kinases [BR:spa01001]
 Serine/threonine kinases: Other
  Bacterial family
   M6_Spy1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AAT87516
UniProt: Q5XAP7
LinkDB All DBs
Position
complement(1372785..1374683)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQNHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKEGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIEENHNVP
QALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRERKIVFEDVESTKPLPKVASG
PTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSGRFLGTLFKILFSFFIVGVAL
FTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKIRQIESDTVAEGNVVRTDPKAG
TAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLIETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMVTEYSYADAVNTLTALGIDASRIK
AYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLSLSDKGEISLYLYPEETHSSSSSSS
STSSSNSSSTNDSTAPGSNTELSPSETTAQTP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcgcattctgaaatctattggccgc
ggtggtatggcggatgtttatttagcaaatgatttgatcttggataatgaagacgttgca
atcaaggtcttgcgtaccaattatcaaacagatcaggtagcagttgcgcgtttccaacgg
gaagcgcgggccatggctgaattgaaccatcccaatattgttgccatccgggatataggt
gaagaagacggacagcaatttttagtaatggaatatgtggatggtgctgacctaaagaga
tacattcaaaatcatgctccattatctaataatgaagtggttagaattatggaagaagtc
ctttctgctatgactttagcccaccaaaaaggaattgtacacagagatttaaaacctcaa
aatatcctactaactaaggagggggttgtcaaagtaactgatttcggcatcgcagtagcc
tttgcagaaacaagcttgacacaaactaattcgatgttaggcagtgttcattacttgtct
ccagaacaggctcgcggctccaaagcgacgattcaaagtgatatttatgcgatggggatt
atgctctttgagatgttgacaggccatatcccttatgatggggatagtgctgttacgatt
gccttgcaacattttcaaaagcctcttccatctattatcgaggagaaccacaatgtgcca
caagctttggagaatgttgttattcgagcaacagccaagaaattaagtgatcgttacggg
tcaacctttgaaatgagtcgtgacttaatgacggcgcttagttataatcgtagtcgggag
cgtaagattgtctttgaggatgttgaaagtaccaaacccctccccaaagtggcctcaggc
cccaccgcttctgtaaaattgtctccccctaccccaacagtgttaacacaggaaagtcga
ttagatcaaactaatcaaacagatgctttacagccccccaccaaaaagaaaaaaagtggt
cgttttttaggtactttattcaaaattcttttttctttctttattgtaggtgtagcactc
tttacttatcttatactaactaaaccaacttctgtgaaagttcctaatgtagcaggcact
agtcttaaagttgccaaacaagaactgtatgatgttgggctaaaagtgggtaaaatcagg
caaattgagagtgatacggttgctgagggaaatgtagttagaacagatcctaaagcagga
acagctaagaggcaaggctcaagcattacgctttatgtgtcaattggaaacaaaggtttt
gacatggaaaactacaaaggactagattatcaagaagctatgaatagtttgatagaaact
tatggtgttccaaaatcaaaaatcaaaattgaacgcattgtaactaatgaatatcctgaa
aatacagtcatcagtcaatcgccaagtgcgggtgataaatttaatccaaacggaaagtct
aaaattacgctcagtgttgctgttagtgatacgatcactatgcctatggtaacagaatat
agttatgcagatgcagtcaataccttaacagctttaggtatagatgcatctagaataaaa
gcttatgtgccaagctctagctcagcaacgggctttgtgccaattcattctcctagttct
aaagctattgtcagtggtcaatctccttactatggaacgtctttgagtctgtctgataaa
ggagaaattagtctttacctttatccagaagaaacacactcttctagtagctcatcgagt
tcaacgtcaagttcaaacagttcttcaacaaatgatagtactgcaccaggtagcaacact
gaattaagcccatcagaaactactgctcaaacaccttaa

DBGET integrated database retrieval system