KEGG   Streptococcus pyogenes MGAS10394 (serotype M6): M6_Spy1501Help
Entry
M6_Spy1501        CDS       T00191                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
spa  Streptococcus pyogenes MGAS10394 (serotype M6)
Pathway
spa00970  Aminoacyl-tRNA biosynthesis
spa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M6_Spy1501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spa03029]
    M6_Spy1501
Enzymes [BR:spa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     M6_Spy1501
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     M6_Spy1501
Mitochondrial biogenesis [BR:spa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    M6_Spy1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AAT87636
UniProt: Q5XAC7
LinkDB All DBs
Position
complement(1492699..1494165)
Genome map
AA seq 488 aa AA seqDB search
MSFNHKTIEELHDLLVAKEISATELTQKTLEDIKSREEAVGSFITVSEEAALRQAAAIDA
KGIDADNLMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDATSVANAYAKDMIVIGKT
NMDEFAMGGSTETSYFKKTKNAWDHTKVPGGSSGGSATAVASGQVRLSLGSDTGGSIRQP
AAFNGVVGLKPTYGTVSRYGLIAFGSSLDQIGPFAPTVKENAQLLNVIASSDVKDATSAP
VRIADYTSKIGRDIKGMKIALPKEYLGEGIDPEIKETVLAAAKQFEALGATVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRADDAKNLDEIYVNTRSQGFGDEVKRRIMLG
TFSLSSGYYDAYFKKAGQVRTLIIQDFDKVFADYDLILGPTTPTVAFGLDTLNHDPVAMY
LADLLTIPVNLAGLPGISIPAGFVDGLPVGLQLIGPKYAEETIYQAAAAFEAVTDYHKQQ
PIIFGGDK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaatcataaaaccattgaagagttgcatgacctccttgtagctaaggagatt
tccgcaaccgaattgactcaaaaaacacttgaagatatcaagtctcgtgaggaggctgtc
gggtcgtttatcactgtttcagaagaagctgctcttagacaagctgcggcaatcgatgcc
aaaggtattgatgctgataacctcatgtcgggtattccactagctgttaaggataatatc
tcaaccaagggcatcctaaccacagccgcttcaaaaatgttgtataactacgagccgatt
tttgatgccacatcagtagcaaatgcctacgctaaagacatgattgtcattggaaaaacc
aacatggacgaatttgccatgggtggttcaacagaaacctcttatttcaagaaaacgaaa
aatgcttgggaccacacaaaagtacctggaggctcatcaggtggttcggcaacagcagtc
gcttcaggacaagtccgtttatctcttggttcagacactggtggttctattcggcagcca
gctgcatttaatggtgttgtcggtttgaaaccaacctatggcactgtttctcgctatggt
ctcattgcttttggaagttcacttgatcagattggaccttttgctccgacagttaaagaa
aacgcccaattattaaatgtgattgcaagtagcgatgtcaaggatgccacttcagcgcct
gttcgcattgcagactacacgtctaaaattggtcgtgatattaaaggcatgaagattgcc
cttcctaaagagtatcttggcgaagggattgatcctgagattaaggaaacggttcttgcg
gcagctaaacaatttgaagccttaggagctactgttgaggaagtcagccttccacatagc
aagtacggtgtggctgtttattatattattgcttcgtcagaagcgtcttcaaacttacaa
cgttttgatggcattcgctatggtttccgtgctgacgatgctaaaaacttggatgaaatc
tatgttaacactcgtagccaaggctttggtgatgaggtgaaacgtcgtatcatgcttgga
acctttagtttgtcatcgggttattatgacgcttatttcaaaaaggccggtcaagtgcgc
actttgattattcaagattttgacaaggtctttgcggattatgatcttattctaggccca
acaacaccgacggttgcttttggcttagacacactcaaccatgatcctgttgccatgtat
ttggccgacttattgaccattccggttaacttagctggtctgccaggtatttctattccg
gcaggattcgtcgatggcttgccagtagggcttcaattaattggtccgaaatacgctgaa
gaaaccatctatcaggcagcagcagcctttgaagcggtgacagattatcacaagcaacaa
ccgattatttttggaggtgacaagtaa

DBGET integrated database retrieval system