KEGG   Spathaspora passalidarum: SPAPADRAFT_136577Help
Entry
SPAPADRAFT_136577 CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa04113  Meiosis - yeast
spaa04138  Autophagy - yeast
spaa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPAPADRAFT_136577
  09143 Cell growth and death
   04113 Meiosis - yeast
    SPAPADRAFT_136577
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    SPAPADRAFT_136577
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spaa01001]
    SPAPADRAFT_136577
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spaa03019]
    SPAPADRAFT_136577
   03036 Chromosome and associated proteins [BR:spaa03036]
    SPAPADRAFT_136577
Enzymes [BR:spaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SPAPADRAFT_136577
Protein kinases [BR:spaa01001]
 Serine/threonine kinases: AGC group
  PKA family
   SPAPADRAFT_136577
Messenger RNA biogenesis [BR:spaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SPAPADRAFT_136577
Chromosome and associated proteins [BR:spaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    SPAPADRAFT_136577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PRR18 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 18869983
NCBI-ProteinID: XP_007374476
JGI: 136577
UniProt: G3AKQ7
LinkDB All DBs
Position
Unknown
AA seq 448 aa AA seqDB search
MTNILRKLHITKSNTGNSASINSQSNSPAPQSIPADKDVNMDYYQQQAKISGDQQSQQHL
VQPVITASNINATPIVTKPDQAISSLKAASATADVAGAGASGAAAAGLAGTSADDAIKRS
LLPQRSTISKGKYSLGDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKYQVVKMKQV
EHTNDERRMLKLVEHPFLIRMWGTFQDAKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF
YAAEVTLALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFAKEVSTVTYTLCGTPDYI
APEVITTKPYNKSIDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILAGKVHYPSFFAPEV
IDLLSKLITSDLTRRLGNLSNGPADIRNHPWFSEVVWEKLLAKDIETPYEPPITAGTGDS
SLFDHYPEEQLDYGIQGEDPYAQYFLDF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgactaacattttacgtaagcttcacattaccaaactgaacacaggtaactctgcatca
attaactcccaatccaactcaccggcaccgcagtccataccagctgacaaagacgttaat
atggactactatcaacaacaagcgaaaatttcaggtgatcaacaactgcaacaacattta
gtgcagccagtcatcactgcgtccaacatcaatgctacacctatagtaactaaacccgac
caggcaattagctccctcaaggccgcatcggccaccgccgatgtagctggtgctggtgct
agtggtgccgccgctgcggggttagctggcaccagtgctgatgacgccattaaacgatca
ttacttcctcagagatcgaccatttccaaggggaaatattctcttggcgatttccacatc
atgagaactttgggtactggttcgtttggaagagtccatttggttagatcggtgcataat
ggaagatactatgccattaaagtattgaagaagtaccaagtggttaagatgaaacaagtc
gaacataccaacgacgaaagaagaatgcttaagttggtggaacatccatttttgattaga
atgtgggggactttccaagatgccaaaaacttatttatggttatggactatattgaaggt
ggtgaattgttctcattgttgcgaaaatcacaaagattccctaatccagtggctaagttt
tatgctgctgaagttacattggcattagaatacttacacagtcacgatatcatatatcgt
gatttaaaaccagaaaatatcttattggatagaaatggtcatataaaaatcaccgatttc
gggtttgccaaagaagtgagtacagttacttatactttgtgtggaactccggattacatt
gctcctgaagtaatcaccacaaagccttataataaatctatcgattggtggtcgcttggg
gttttaatttttgaaatgttggctggttacactccattttatgatacaactccaatgaag
acctatgaaaagattttggctggtaaagtccattaccccagtttctttgccccagaagtg
attgatttattgagtaaattgattactagtgatttgactagaagattgggtaatttaagc
aatggtcctgctgatattagaaaccatccttggtttctggaggttgtatgggagaagttg
ttagccaaggacattgagaccccttacgaacctccaatcactgccggtaccggtgattct
tccttgtttgatcattatcccgaagaacaattggactatggtatccaaggagaagacccc
tatgcacaatactttttggatttctaa

DBGET integrated database retrieval system