KEGG   Spathaspora passalidarum: SPAPADRAFT_137588Help
Entry
SPAPADRAFT_137588 CDS       T03101                                 

Definition
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K00601  phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00230  Purine metabolism
spaa00670  One carbon pool by folate
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
Module
spaa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPAPADRAFT_137588
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPAPADRAFT_137588
Enzymes [BR:spaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     SPAPADRAFT_137588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-GeneID: 18870058
NCBI-ProteinID: XP_007374968
JGI: 137588
UniProt: G3AMK9
LinkDB All DBs
Position
Unknown
AA seq 237 aa AA seqDB search
MTLNITVLISGSGTNLQALIDAEKNGKLKGKITQVISSSDTAFGLTRAERASIPTKTHIL
KEYYKGTTKEQKDERKAKRELFNSDLANLLIYGNIKGEKEDDYIKPNLIVCAGWMLILSP
IVLEPLAKAGITIINLHPALPGAFEGTHAIDRCWKAGQDGEITKGGVMIHRVIAEVDRGE
PILVKEIDLKKEETLEEYEDRVHKVEHVAIVEGTNIILDELSVDEASEALDKLKVKN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaatataacggttttgatatccgggtcaggtaccaatttgcaagcactcatc
gatgctgaaaagaatggcaagttgaaaggtaagataacacaagttatatcatctagtgat
actgcgtttggtttaactcgggctgaaagggcatcaattcctaccaagactcatattttg
aaagaatattacaagggaactactaaagaacaaaaagacgaacgtaaagccaaaagagaa
cttttcaattctgatttggccaacttgttaatctatggtaatattaaaggtgaaaaggaa
gatgactatataaaaccaaatcttatcgtatgtgctggatggatgttaattttatctcct
attgttttggaacctttggccaaagcaggtataactattatcaacttacatccagcatta
cctggtgcatttgaaggtactcatgccattgatagatgttggaaagctggtcaagatggc
gaaattactaaaggtggagttatgattcatagagttattgctgaagttgatagaggtgaa
cctattttggtcaaggaaattgacttgaagaaggaagaaactttggaagagtatgaagac
agagtccacaaggttgaacatgttgcaatcgtagaaggaacaaatattatcttggatgag
ttgagtgttgatgaagctagtgaagctttggataagttgaaagttaagaattag

DBGET integrated database retrieval system