KEGG   Spathaspora passalidarum: SPAPADRAFT_139122Help
Entry
SPAPADRAFT_139122 CDS       T03101                                 

Definition
(RefSeq) Glucoamylase 1 precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00052  Galactose metabolism
spaa00500  Starch and sucrose metabolism
spaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPAPADRAFT_139122
   00500 Starch and sucrose metabolism
    SPAPADRAFT_139122
Enzymes [BR:spaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SPAPADRAFT_139122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 18870180
NCBI-ProteinID: XP_007375620
JGI: 139122
UniProt: G3AQ23
LinkDB All DBs
Position
Unknown
AA seq 950 aa AA seqDB search
MILSSVVKTAIALAMLGYSAASPTPSSSSVADSHPTVPNELTLGVKQVPNILNETAVDAN
QVAKGYSLTNVTATPRGLTGLLNLKGATNIYGYDFDKLNLTVTYQSDNRLNVRIAPVNLT
DVYILPESLVALPKVEGDVNTFEFENSDLIFSYDSENFGFEVKRASTAEVLFSTKGNPLV
FSNQFVQFNTTLPKGHQITGLGESIHGSLNEPGTVKTLFANDVGDPIDGNIYGVHPVYYD
QRYDTGTTHGVYWRTSAIQEVVVEDQSLTWRALSGVIDLYFFSGPDPKDVIQQYVKEIGL
PAMQPYWALGYHQCRWGYDTIDDVKNVVENFKKFNIPLETIWTDIDYMDTYKDFTNDPYR
YPTDKYQQLLEELHSNNQHYVPIFDAAIYVPNPNNATDNAYTPFHAGNESDIFLKNPDGS
LYIGAVWPGYTAFPDFLNNKTQEYWNEQFKTWHDRIPFDGIWTDMNEVSSFCVGSCGSGR
YFDNPVHPPFAVGAPATSYPLNFNVTNATEWASISSAIAATASTPVPEATSSSSSSIDSK
NTLAPGKGNINYPPYAINNAQGDHDLATHAVSPNATHVDGTVEYDIHNLYGFTQEKAIYN
ALLNIAPDKRPFIIGRSTFAGAGHYVGHWGGDNSADYDMMYFSIPQAFSMGLSGVPFFGV
DVCGFNGNTDMELCSRWMQLGSFFPFYRNHNVLGAISQEPYVWESVTEAAKTSMNIRYLL
LPYYYTLLHESHTSGLPILRSFNWEFPYDKKLSGIDNQFFVGDALVVTPVLQPGVDKVKG
VFPGTDEVYYDFYTTEKQNFKNDKNETLDAPLGHIPLHIRGGHILPTQEPGYTTTESRKN
PFGLLVALDKDGKAAGKLYLDDGESLNVTESLYVDFVAGDNELSVSAFGDYKVEQPLANV
TILGVDKKPEGVKFGDSKVNYKYEKGTVYITGLEKYTKEGAFAEEFTVSW
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgattctttcaagtgtggtcaaaactgccattgcattagcaatgcttggctatagtgct
gcttcgcctactccatctctgagtagtgttgctgattcccaccctactgttcctaacgaa
ttgacccttggtgtcaagcaagtgccaaatattctcaatgaaactgccgttgatgctaac
caagttgctaaaggttactcgcttactaacgtcactgctactcctcgtggtcttactggg
ttattgaacttgaaaggtgctaccaatatttacggttatgattttgacaaacttaacttg
actgtcacttaccaactggacaacagattgaacgtccgtatcgctccagttaacttgacc
gacgtgtacatcttgccagaactgttggttgcattgcctaaagttgaaggtgatgtcaat
acatttgaatttgaaaactccgatttgattttcagttacgacagtgaaaatttcggattt
gaagtcaagagagcttctactgccgaagtcttattctccaccaaaggtaacccattggtg
ttctctaaccaatttgttcaattcaataccactttaccaaagggccatcaaatcactggg
ttgggtgaatctatccacggctccttgaatgaaccaggtaccgtcaagaccttatttgct
aatgatgtcggtgatccaatcgatggtaacatctatggtgtccacccagtctactatgat
caaagatatgatactggaactactcacggtgtttattggagaacctctgctattcaagaa
gtggttgttgaggaccaatcgcttacttggagagccttgtctggtgttattgacttatac
ttctttagcggtcctgatccaaaggatgtcattcaacaatatgttaaggaaatcggttta
cctgctatgcaaccatactgggccttgggttaccatcaatgtcgttggggttacgacacc
atcgatgatgtcaagaatgttgtggaaaacttcaagaagttcaacatcccattagaaacc
atctggactgatatcgattacatggacacttacaaggatttcactaatgatccatacaga
taccctactgacaagtaccaacaattattggaagaacttcactccaacaaccaacattat
gttcctattttcgatgctgccatttatgttcctaacccaaacaatgccactgacaacgcc
tacactccattccatgccggtaacgaatccgacattttcttgaagaaccctgatggaagt
ttgtacattggtgccgtgtggcctggttacactgccttcccagatttcttgaataacaag
acccaagaatactggaatgagcaattcaagacttggcacgacagaattccattcgatggt
atctggactgatatgaacgaagtcagttccttctgtgttggttcctgtggtagtggaaga
tactttgacaacccagtccacccaccatttgctgttggtgctccagcaacttcataccca
ttgaactttaatgttactaatgctactgaatgggcctccatttcctccgctattgctgcc
actgcatctaccccagttccagaagccacttcttcttcatcttcatccattgattccaag
aacactcttgctccaggtaagggtaacatcaactatccaccatatgctatcaacaatgct
caaggtgatcacgatttagccacccatgctgtttctccaaatgctacccacgttgacggt
actgttgaatatgatattcacaacttgtatggtttcacccaagaaaaggccatttacaat
gccttgcttaacattgctccagacaagagaccatttattatcggtagatccacctttgcc
ggtgccggacactatgttggtcactggggtggtgacaacagtgctgattatgacatgatg
tacttttccattccacaagccttttccatgggtctttctggtgttccattctttggtgtt
gacgtttgtgggttcaatggtaacactgatatggaattgtgttctagatggatgcaattg
ggttccttcttcccattctatagaaaccacaatgtccttggagccatttcccaagaacct
tatgtctgggaactggttactgaagctgccaagaccagtatgaacatcagatacttgttg
ttgccatactactacaccttgttgcacgaatcccatactagtggtttacctatcttgaga
tcattcaactgggaattcccatacgacaagaagttgagtggtattgacaatcaattcttt
gttggtgatgctttggtggttactccagtcttacaaccaggtgttgacaaggtcaagggt
gtcttcccaggtactgacgaagtctactacgacttctacaccactgaaaagcaaaacttc
aagaatgacaagaatgaaactctcgacgctccattaggtcacattccattacatatcaga
ggtggacacattcttccaactcaagaaccaggatacactactactgaatccagaaaaaat
ccattcggattgttggttgccttggacaaggatggtaaggctgctggtaagttgtacctt
gacgatggtgaaagtttgaatgttaccgaaagcttgtatgttgatttcgtcgctggtgac
aatgaattgtctgtcagtgcctttggtgactacaaggtcgaacaaccattggctaatgtt
accatcttgggtgttgacaagaagccagaaggtgtcaagtttggtgattccaaggttaat
tacaagtacgaaaagggtactgtttacattaccggtttggaaaagtacaccaaggaaggt
gcatttgctgaagaatttactgtctcttggtaa

DBGET integrated database retrieval system