KEGG   Spathaspora passalidarum: SPAPADRAFT_151563Help
Entry
SPAPADRAFT_151563 CDS       T03101                                 

Definition
(RefSeq) dsDNA break repair ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SPAPADRAFT_151563
Enzymes [BR:spaa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SPAPADRAFT_151563
DNA repair and recombination proteins [BR:spaa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     SPAPADRAFT_151563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase BRCT DNA_ligase_A_C mRNA_cap_enzyme RTT107_BRCT_5
Motif
Other DBs
NCBI-GeneID: 18870899
NCBI-ProteinID: XP_007374961
JGI: 151563
UniProt: G3AMK2
LinkDB All DBs
Position
Unknown
AA seq 948 aa AA seqDB search
MPFFLDNVPTPKNNLEPSYRFLNDELFIKLDAVNKQTLGEFKNISDKKAYIINSFIQQFK
LHIGNDIYPSARLIFPDKAGRLYYIKDIVLARLIIKMYSIPKDSDDYSMLYNWKLQYQKT
KRFTVDQHKLRDLPLQAARIISNRRNYMNETHEFSVADINAKLDALNLAKKSAEQIEILK
PLFDTLTIPELRWLIHIILKKTILGFFENYFLNSWHPDASRLYSICNNLQKTVNYLVDPN
TRVDPNLLTVHPFYPFKPQLAQKLSSSYAKLIKDFQKITDMEPQMQTLFDKLDLKDKFYI
EEKMDGDRMVLHKEGPHFKFYSRRLKDYSFLYGENYEFGSLTKYLTEAFPGNVDSVILDG
EMVAYDYVRKAILPFGTLKSSAIQESVRQYTIIDQYEQQSSYPYFLVFDILYLNGRNLTN
YPLFFRKNILNKVIRPIPNRFEIHDSRISSSIEDIKRAIREIVGSRSEGLVLKHTQSKYH
IGYRNLKWIKLKPEYLEKFGENLDLVVIGKVPGVKNSYMTGLRNETDGSYYSFCMCANGF
TNEEFDKIERITHGKWIKTKDQIPSKSVIQFGTKQPPWWINPRDSLVLEIKARSIDAQSE
KTFAVGSTLHNMYCRRIRTDKNIDECISMQEYFQLKEKFSTDVLKSQSAALKRKQLHNLD
LFNESTIKKQRVESNLFARFNFMIVSDKLDPITGERTSREELMKLVKKYGGNLINAVDVL
TADRMLVITEKMLPLCESFINRGIDLIKPNWIFECINRGTILQLEPFFIFSTSNWDKYTV
GKVDQFGDSYIIYNSITELSIPRLSDSELRGARKLHMHEWGDQRPKLYLFLDTNFFVVGD
TMSAKFLGQRIMRYTGEITKDINGCSYIVVPIYDDEKNRIETLDAVNKISSKISEGLLFD
EGSFTRIPFIVTEKFIDQCIKENCIVDPEDYKYYQKQISFSKKSFAIN
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgccattctttctagacaatgtacccacacccaagaacaatctcgaaccatcataccgg
tttctcaatgatgaattgtttatcaagctagatgccgtaaacaaacaaacacttggtgag
ttcaaaaacatatctgataagaaagcgtatattattaactctttcatccagcagttcaaa
ctacacattgggaatgacatataccccagtgcgagattaatatttcccgacaaggcagga
agattatactatattaaagatatagtattagcgcgattaattattaaaatgtacagcatt
cctaaggattcagacgattacagcatgttatacaattggaagctacaataccaaaagaca
aaaaggtttaccgttgaccaacataaacttcgcgatttaccattgcaagcggcaagaatt
atttccaacaggaggaattacatgaatgaaactcatgaattcagtgttgccgatatcaac
gcaaaacttgacgcgttaaatttggccaagaagtcagccgaacaaattgagatattgaag
ccattatttgatacattgaccattcccgaattacgctggttgattcatattattcttaaa
aagaccatacttggattttttgaaaattatttcttaaatagctggcatcctgatgcaagc
cgattatattctatttgtaataatttgcaaaaaacagtaaattacttggttgatccgaat
acaagagtagatcccaatttattaactgtccatccattctatccattcaagccacagttg
gcgcaaaagttgagtagttcatatgccaaattaatcaaagacttccagaaaataaccgat
atggaaccacagatgcaaacattattcgataaattagatctaaaagataaattttacatt
gaggaaaaaatggatggcgatagaatggtattgcataaagaaggaccccatttcaaattt
tattcccgtcgattaaaagattattcattcttgtatggagaaaactatgaatttggttca
ttgacaaagtatctaactgaagcatttcctggtaatgtagactcggtgattttagatgga
gaaatggtggcttatgattatgttaggaaagcaattcttccatttggtacattaaaatct
ctggctattcaagaaagtgtgcgacagtacaccattattgatcaatatgaacaacaatct
tcatacccttacttcctcgtgtttgatatactttacttgaatggacgcaatctaaccaac
tatcccttgttctttaggaagaacatcttgaataaggttatccgacctattcctaatcgg
tttgaaatccacgattcaagaattagttccagtatagaagacataaaacgagcaattcga
gaaattgtcggcagtagaagtgaggggttggtattgaaacatacacagctgaagtatcat
attgggtaccgtaatctcaaatggataaaattgaaaccagaatatttagagaaattcgga
gagaatctagatcttgttgtcattggcaaagtgcctggggtcaagaattcatacatgacc
ggactccggaatgaaactgatggatcatattatagtttctgcatgtgtgccaatggtttt
accaatgaagaattcgacaagattgaacgtataactcatggaaaatggatcaagactaaa
gatcaaataccttctaaactggttatacagtttggaaccaaacaaccaccttggtggatc
aatcctcgagattcactagtattggaaattaaagcaagatccattgatgcccaaagtgaa
aagacattcgcggtgggatcaactttgcacaacatgtattgtagaagaataagaactgac
aagaatatagatgaatgtatctcaatgcaggaatacttccagttgaaggaaaagtttctg
actgatgtattaaaatctcaaagtgctgcattgaaacggaagcagttgcataacttggat
ttatttaacgaatcaactatcaaaaagcaaagagtagaatcaaatttgtttgctaggttt
aatttcatgattgtcagtgataagttggatcctataactggtgaacgaacttcgcgagag
gagttgatgaagttggttaagaagtatgggggtaatttgatcaatgcagttgatgtgttg
actgcagataggatgctcgttatcactgagaagatgcttccactttgtgaatcatttatc
aatcgaggaatcgatttaataaaaccaaattggatattcgagtgtattaatcggggaact
atactacagttagagccattctttatattcagtacttctaactgggataagtataccgtt
gggaaagtagatcaatttggcgattcgtatattatatataatctgatcactgaattatct
atccctaggttgagtgacagtgaattaagaggagcaagaaaattacacatgcatgaatgg
ggagatcaaagacccaaattgtacttgtttcttgataccaacttctttgttgtaggtgat
accatgagtgcaaagttcttggggcagcgaattatgaggtatacaggagaaatcaccaag
gacatcaacggttgttcctatattgttgtgccaatatatgacgatgagaagaatagaata
gagactttggatgctgtcaataaaatctcttctaaaatcagtgaaggtttactatttgat
gaagggtcattcacgaggatcccattcattgtaactgaaaagtttattgatcagtgtata
aaagagaattgtattgttgatcctgaagattataagtactaccaaaagcagatttctttt
ctgaagaaaagttttgcaatcaattaa

DBGET integrated database retrieval system