KEGG   Spathaspora passalidarum: SPAPADRAFT_47961Help
Entry
SPAPADRAFT_47961  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00310  Lysine degradation
spaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    SPAPADRAFT_47961
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spaa03036]
    SPAPADRAFT_47961
Enzymes [BR:spaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     SPAPADRAFT_47961
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     SPAPADRAFT_47961
Chromosome and associated proteins [BR:spaa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SPAPADRAFT_47961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 18871161
NCBI-ProteinID: XP_007372307
JGI: 47961
UniProt: G3AFA5
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MASDDILSSDELTLVDYPETALQLISPLFSVDKTVYGGRGCFAKSIIPSGTIIHRCSSPI
SSSIARPFKKEVCHYCFKYDNGKTWKIKRSQQFGKQMCSIVFCTEECRDKFSQEDGEGIY
LKNLMLVEKNYLQGLKKHEVEPKEPKDLDTEILQEWEKVGSWEEKLKTMKPSKRESILPR
IDESEYLEINYVIGALFSMYKYGNSGITSPEYFQDIKREEQNQFELQYFNTLQSTELEKV
RKYPYLLYSYINIYKFLKLTVSEQLQPYINTDEIRCIIGRNLSNAFGIWSEVSDPKEDKE
FLGFGVYPSASFFNHSCAPNLVKTRIGNQLVFTTLRDISAGEELCINYGNFFG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgatgatatactactgagtgatgaattaactttggttgattatccagaaaca
gcgttacaacttatatctcctttatttagtgtggataaaaccgtatatggaggtcgagga
tgttttgccaaatcaataataccaagtgggacaataatacatagatgttcctcgccaata
agttcgtccatagcgagaccattcaagaaagaagtgtgtcactactgtttcaagtatgac
aatgggaagacatggaagattaaacgttcacaacaatttgggaagcaaatgtgttctata
gtgttttgtactgaggaatgtcgagataagttttcacaagaagatggagaaggtatctat
ttgaaaaatttgatgcttgtggagaagaactatttacaagggttaaagaaacatgaggtg
gaaccaaaagaaccaaaggatctcgatactgaaatactacaggaatgggagaaagtgggt
agttgggaagaaaaattaaagaccatgaagccttcaaaacgtgaaagtatactaccaaga
attgatgaaagtgaatatttggagattaattatgtgattggggcactatttagcatgtac
aaatacggaaattcgggaatcacttcacctgagtatttccaagacattaaacgagaagaa
caaaatcaattcgaattacaatatttcaatactttgcaatcaaccgaattggaaaaggta
cgaaaatacccgtatttgttatattcgtacatcaatatctataaatttcttaaactcacg
gttagtgaacaattgcagccgtacataaataccgatgaaataaggtgtattattggtaga
aacctatctaatgcatttgggatctggtcagaagtttctgacccaaaggaagataaagaa
ttcttgggatttggagtatatccatcagcatcatttttcaaccattcatgtgcgccaaat
cttgtcaagactagaattgggaatcaattggtatttacaacattaagggatatttctgct
ggagaagagttgtgtattaactatgggaatttttttggatga

DBGET integrated database retrieval system