KEGG   Spathaspora passalidarum: SPAPADRAFT_56206Help
Entry
SPAPADRAFT_56206  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa03030  DNA replication
spaa03410  Base excision repair
spaa03420  Nucleotide excision repair
spaa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spaa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPAPADRAFT_56206
   03410 Base excision repair
    SPAPADRAFT_56206
   03420 Nucleotide excision repair
    SPAPADRAFT_56206
   03430 Mismatch repair
    SPAPADRAFT_56206
Enzymes [BR:spaa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SPAPADRAFT_56206
    6.5.1.6  DNA ligase (ATP or NAD+)
     SPAPADRAFT_56206
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SPAPADRAFT_56206
DNA replication proteins [BR:spaa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SPAPADRAFT_56206
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SPAPADRAFT_56206
DNA repair and recombination proteins [BR:spaa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SPAPADRAFT_56206
   NER (nucleotide excision repair)
    Other NER factors
     SPAPADRAFT_56206
   MMR (mismatch exicision repair)
    Other MMR factors
     SPAPADRAFT_56206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 18872015
NCBI-ProteinID: XP_007376120
JGI: 56206
UniProt: G3ARS5
LinkDB All DBs
Position
Unknown
AA seq 715 aa AA seqDB search
MAPQQQSIARFFGGGATLAKKKDLNPSSPTKKRPLSPPPPTASPDKRTKITPETAVKVGE
SEIHEDTDPEIDEPVKPKSQLDEAQELIKLSKEHQHDKPVVVSSKIPYATLTSILEKIEN
ESSRLKIISILSQFFEDILSASSIDKLIKIVYLVINRLGPDYEPDLELGLGETLLIKAIS
EGYGRATSKIKSDYKEVGDLGLVAQKSRSGQPTMFKPQPLDIDTVFANLTQIARSTGKDS
QSKKIGIINKMLTACDPKTNEAKFLIRSLEGKLRIGLAEKTVLIALAQAFVNHEKKHKVH
ADELSKAEDIIREAFSQIPNYEVIIKNASEHGVFNLLDHVRLTPGIPVKPMLAKPTKSIG
EVLDRFQHEEFTCEYKYDGERAQVHVLPDASVRIYSRNSEDMSQRYPDLISIITEFSKQQ
ELHSMILDCEAVAWDRVQNKILPFQVLSTRKRKDVNEKDITVHICLFAFDLIYYNGESLI
TKSLAERREVLYNNFTTIEGKFQFATKKDSSNLDELQLFLDQSVKDSCEGLMVKMLNGTE
SFYEPSKRSRNWLKLKKDYLAGVGDSLDLVVIGAYNGRGKRTGTYGGFLLASYNQDSGEL
ETTCKIGTGFSDEDLTNLYNKLHPTEIPNPRPHFVYDSTNSNAAPDVWFEPSLLFEVLTA
DLSLSPIYKAAHTEYGKGISLRFPRFLRIRDDKGIEDATSSTEVAEFYERQAHVN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctccacaacaacaatccatcgccaggttctttggtggtggcgcaaccttagcaaag
aaaaaagacttaaacccttcttcccctacaaaaaaacgaccactttccccaccacctccc
accgcctcccccgacaaacggaccaagatcacccctgaaaccgccgtcaaggtaggcgag
tccgaaattcacgaagacaccgaccccgaaattgacgaacctgtgaagccaaagtcgcaa
cttgatgaagcacaggagttgattaaactcagtaaagaacaccagcatgacaagccagtc
gtggtgtcttcgaaaatcccttatgccacattgacttccattttggaaaagattgaaaac
gaatcttcccgattgaagatcatcctgatcttgtcccagttctttgaagacatcttactg
gcatcgtccatcgacaaacttatcaagattgtgtatcttgtgattaatcgattaggtccc
gactacgaacctgatttggaattgggtctcggtgagacattgcttatcaaggcaatcagt
gaaggatacggccgggccacgagcaagatcaagctggactataaagaagttggagatttg
ggtctagtggcccagaaatcgagaagtggacaacctaccatgtttaaaccacaaccgttg
gacatcgacaccgtgtttgccaatttgacccagattgccaggtccaccggtaaggactcc
cagctgaagaagatcgggatcattaacaagatgttgacggcgtgcgatcccaaaactaac
gaggcaaaattcttaattaggtcgttggaagggaaactcagaattggattggcggaaaag
actgtgcttattgccttggcacaggcgttcgtaaatcatgaaaagaagcataaagtgcac
gcggacgagttgagcaaggcagaggatataattagagaagcattctcgcagattcccaat
tatgaagtgataatcaagaatgcatctgagcatggagttttcaatttattggaccatgtc
aggttaaccccaggtatccccgtgaagcccatgttggcaaaacctaccaaatccattggt
gaagtattggacagattccagcacgaggaatttacctgtgagtataaatacgatggcgaa
cgtgctcaagtccacgtcttgcctgatgctagcgtgaggatctactcgagaaactcagaa
gacatgtcacaaaggtatcccgacttgatctcaatcattactgaattcagtaaacagcaa
gaattacactcgatgattctcgactgtgaagcagtagcgtgggatcgtgtccagaataaa
atcctcccctttcaagtgttatccacgagaaagagaaaggacgtgaatgaaaaggacatc
acggtgcacatctgtctttttgcatttgatttgatttactataatggggaatccctaatt
acaaaatcgctcgcagagagacgagaggtgttgtacaacaacttcaccaccattgaaggg
aaattccagttcgccacgaaaaaggactcgtccaacttggacgaattgcaattgttcctt
gatcagtccgtcaaggactcgtgtgagggattgatggtgaagatgttgaatggaaccgag
tccttctacgaaccatcaaaacggtcgagaaactggcttaaattaaagaaggactatttg
gctggtgtaggcgattcccttgacttggtcgttattggcgcgtataacggtagggggaag
agaaccgggacgtacggtgggttcttgcttgcttcgtataatcaagattcgggcgagttg
gaaaccacatgtaagataggaacggggttcagtgatgaagatttaaccaatttgtataat
aagttacaccccaccgagattcctaatcctagaccacattttgtgtatgattccaccaat
tcaaatgctgctcctgacgtatggtttgaacctagtttattattcgaagtattgactgct
gatttgtcgttgagtccaatttataaagctgctcataccgagtatggaaagggtatttcc
ttgagattccctcgtttccttagaattagagacgataagggaatcgaagatgccacaagt
tcaaccgaagttgcagaattctacgaacgtcaagctcacgtaaactag

DBGET integrated database retrieval system