KEGG   Spathaspora passalidarum: SPAPADRAFT_56230Help
Entry
SPAPADRAFT_56230  CDS       T03101                                 

Definition
(RefSeq) Glucoamylase GLU1 precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00500  Starch and sucrose metabolism
spaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPAPADRAFT_56230
Enzymes [BR:spaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SPAPADRAFT_56230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 Imm41
Motif
Other DBs
NCBI-GeneID: 18872019
NCBI-ProteinID: XP_007376151
JGI: 56230
UniProt: G3ARV6
LinkDB All DBs
Position
Unknown
AA seq 529 aa AA seqDB search
MKLSNFLLYSIAFTQTVSGIVIPQHVLDGEPPAPISPYQSISDLDFETWLEKQKAESFHS
ILNNIGGTSEVFDEMEVYKGVVIASPSKIYPNYFYQWTRDAAITIKTLLYELEDQLNTSS
SEVSKDTGKLVNVIESYIENSYNLQRLPNLSGSFEDDDKSGLGEPKFHVNNTPFNEVWGR
PQRDGPGLRAATIMYYLEILNKFDKQVQSEFLKSTGFIYKKIIKPDLIYIMKNWDLEGFD
LWEEINAVHFFTSITQLRAIKDGIFWAEHFHDESFKESLVSTFGELQEAIENELGFKSDM
LPHIIECPSIWKIGKRKGLDAASLLGSIHSHETSELRRDDPLPIPFDIDDSSIINTLAAM
VADMKFRYPINHNKIGLFGTGVALGRYPEDIYDGYSTTEGNPWFISTATAGEIIYRMIFK
LKSYRQDIIINASNRDFFHQFINFENSDDEGDDMVIPFNSAAYNMMIANLFKFSDSFLQV
VKEHVDSQGRMSEQFNKYHGYMQGARELTWSYSAVWNAIRWREKTLKVL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatccaatttcctactatattccattgcatttactcaaactgtttctggtatt
gtgattcctcaacatgttcttgatggagaacctcctgcccctataagcccatatcaaagt
atatcagatcttgactttgaaacttggcttgagaaacaaaaggcagagtcatttcacctg
attttgaataacatcggcggtacaagtgaagtgtttgatgaaatggaggtatacaagggt
gtggtgattgcctctccttcgaagatctatcccaattacttttatcaatggacaagagat
gcagctataacaataaagactttattatatgaattggaggatcagctcaacacttctagt
tctgaagtttccaaagataccggtaagctcgttaatgttattgaaagttatattgaaaat
agttataatttgcaaaggttaccaaatctttcaggttcttttgaagatgatgacaagagc
ggattgggggaacctaaattccatgttaataataccccattcaatgaagtctggggaaga
cctcaaagggatggtccaggtttaagggcagccactattatgtattatcttgagatattg
aacaagtttgataagcaggttcaatctgaatttttgaaatcaactgggttcatttacaag
aagattataaagcctgacttgatctacattatgaagaactgggatttagaagggtttgat
ctttgggaagaaattaatgctgtccactttttcacctcaattactcaattgagggcaatc
aaggatggtatcttctgggctgaacatttccatgatgaatcattcaaagaaagcttagtt
tctacgtttggtgaattacaggaggcaattgagaatgaattagggtttaaatcggatatg
ttacctcatataatcgaatgcccttcgatctggaagattgggaaaagaaaaggtttggat
gctgcttcattacttggatccatacactcccatgaaacttctgaacttagaagagatgat
ccgttaccaatcccatttgatattgacgatagttctattatcaatactcttgctgccatg
gttgccgatatgaagtttagatatccaattaatcataacaagattggtctttttggcact
ggtgtagcattgggaagatatcctgaagatatatatgatggttattctactacagaaggt
aacccatggtttattagtaccgctactgccggagaaatcatttataggatgatttttaag
ttgaaatcatatcgacaggatataattattaatgcttctaaccgggactttttccatcaa
tttattaactttgaaaacagtgatgatgaaggcgacgatatggttattccttttaattca
gctgcatataatatgatgatagctaacttgttcaagttctcagattcgtttttgcaagtg
gttaaggaacatgttgattctcaaggaagaatgtccgagcagtttaataaataccatgga
tatatgcaaggtgcacgcgaattaacttggagttatagtgccgtttggaatgctattaga
tggagagaaaagactttaaaggttttataa

DBGET integrated database retrieval system