KEGG   Spathaspora passalidarum: SPAPADRAFT_58964Help
Entry
SPAPADRAFT_58964  CDS       T03101                                 

Definition
(RefSeq) succinate dehydrogenase flavo protein subunit mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00020  Citrate cycle (TCA cycle)
spaa00190  Oxidative phosphorylation
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
spaa01200  Carbon metabolism
Module
spaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spaa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAPADRAFT_58964
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAPADRAFT_58964
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPAPADRAFT_58964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 18872700
NCBI-ProteinID: XP_007373176
JGI: 58964
UniProt: G3AET4
LinkDB All DBs
Position
Unknown
AA seq 649 aa AA seqDB search
MLTSVRNQLGRSAAIKRSVLSTSVRALSCSTVRSAVVGSNVKGQDFNASKYMGQKYHIVD
HEYDCLVVGAGGAGLRAAFGLASEGYKTACISKLFPTRSHTVAAQGGINAALGNMHPDDW
HWHFYDTVKGSDWLGDQDAIHYMTKEAPKSIYELEHYGVPFSRNEEGRIYQRAFGGQSKE
YGKGGQAYRTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFAMDLMMQDGACIGAIAYNQ
EDGTLHRFFANRTVMATGGYGRAYFSCTSAHTCTGDGYAMVARAGLPLEDMEFVQFHPSG
IYGSGCLITEGARGEGGFLLNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGP
DKDHMYLQLSHIPAAILKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWKG
EVLKQGKDGKDEIVPGLLACGEVACASVHGANRLGANSLLDLVVFGRAVSHTIRDTLKPG
APIKTHEKDIGHDSIANLDKLRNANGTKNTADIRLDMQKTMQKGCAVFRTQETLDKCAKL
IGEIDQSFADVKTTDRSMIWNSDLVETLELQNLLTCAAQTVNSAAARKESRGAHARDDFP
DRDDVNWRKHSLSYQDKSGDKVRLAYRDVIAHTLDESDCKPVPPAKRVY
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttctgttcgcaaccaattgggtagaagtgcagccatcaagagatctgtttta
tccacatctgttagagcattgtcttgttctaccgtcagatctgctgtcgtcggttccaat
gtcaagggtcaagacttcaatgcttccaaatacatgggtcaaaagtaccacattgttgat
cacgagtacgactgtttagttgttggtgctggtggtgctgggttgagagctgctttcggg
ttagcttctgaagggtacaagactgcttgtatttccaaattattcccaaccagatcccat
actgtcgctgctcaaggtggtatcaatgctgctttgggtaacatgcatccagatgactgg
cactggcatttctacgataccgtcaagggttccgattggttaggtgatcaagatgccatc
cactacatgaccaaggaagctccaaagtccatttatgaattagaacactatggtgttcca
ttctctagaaatgaagaaggtagaatctaccaacgtgcatttggtggtcaatccaaagaa
tacggtaaaggtggtcaagcttacagaacctgtgctgttgctgatagaactggtcacgct
ttattgcactccctttacggtcaatcattaagacatgacacccatttctttattgaattc
ttcgccatggatttgatgatgcaagatggtgcttgtatcggtgctattgcttacaaccaa
gaagatggtaccttgcatcgtttctttgccaacagaactgtcatggccactggtggttat
ggtagagcttatttctcatgtacctctgcccacacttgtaccggtgatggttacgccatg
gtcgctagagctggtttgccattggaagatatggaattcgtgcaattccatccttctggt
atttacggttccggttgtcttatcaccgaaggtgctagaggtgaaggtggtttcttactt
aactctgaaggtgaaagatttatggaaagatatgctccatcagccaaggatttagcttct
agagatgttgtttccagagccattactatggaaattaacgaaggtagaggtgttggtcca
gacaaggatcacatgtacttacaattgagtcacatcccagctgctatattaaaggaaaga
ttaccaggtatttctgaaactgcccatattttcgctggtgttgatgttaccaaggaacca
attccaattttaccaactgtccattacaatatgggtggtattccaaccaactggaagggt
gaagttcttaaacaaggtaaggacggtaaggatgaaattgtcccaggtttgttggcttgt
ggtgaagttgcttgtgcttctgtccatggtgctaatagattaggtgccaactccttgtta
gatttagttgttttcggtcgtgctgtttctcacaccattagagataccttgaaaccaggt
gccccaatcaagactcacgaaaaggatatcggtcatgactctattgccaacttggacaaa
ttaagaaatgccaacggtaccaagaacactgctgatattagattagacatgcaaaagact
atgcaaaagggatgtgctgttttcagaactcaagaaaccttggacaagtgtgccaagttg
attggtgaaattgatcaaagttttgctgatgtcaagaccaccgaccgttctatgatttgg
aactctgatttagttgaaacccttgaattacaaaacttgttaacttgtgctgctcaaacc
gttaattctgccgctgctagaaaggaatctagaggtgcccacgccagagatgatttccca
gacagagacgatgtcaactggagaaagcacagtttgtcataccaagacaagtccggggac
aaggttcgtttagcataccgtgatgtcattgctcatactttggatgaatctgactgtaaa
ccagttcctccagccaagcgtgtctattaa

DBGET integrated database retrieval system