KEGG   Spathaspora passalidarum: SPAPADRAFT_59621Help
Entry
SPAPADRAFT_59621  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00020  Citrate cycle (TCA cycle)
spaa00190  Oxidative phosphorylation
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
spaa01200  Carbon metabolism
Module
spaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spaa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAPADRAFT_59621
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAPADRAFT_59621
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPAPADRAFT_59621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer2 Fer4_10 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 18872994
NCBI-ProteinID: XP_007373775
JGI: 59621
UniProt: G3AHM7
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MIRSIIPIIRQPQQLQFGLRALATAAAQQSPRLKKFQIYRWNPDTPEVQPKLQTYEVDLN
NCGPMVLDALLKIKNEQDPTLTLRRSCREGICGSCAMNIGGRNTLACLCRIEPDTSKDLK
VYPLPHMFVVKDLVPDLTHFYKQYKSIQPYLQRDTNPADGRENLQSIEDRAKLDGLYECI
LCACCSTSCASYWWNQQQYLGPAVLMQAYRWLIDSRDEYTSNRKVMLQNSMSLYRCHTIM
NCTRTCPKGLNPGKAIAEIKRLLAFD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatcagatcaatcattccaatcattcgtcaaccacaacaattacaattcggattaagg
gctttagccactgctgctgctcagcaatccccaagattaaagaagttccaaatttataga
tggaacccagacactccagaagtgcaaccaaaattgcaaacttatgaagttgacttgaac
aattgtggtcctatggttttggatgctcttttaaagattaagaacgaacaagatcctacc
ttaaccttgagaagatcttgtcgtgaaggtatctgtggttcttgtgccatgaacattggt
ggtagaaacacattggcctgtttatgtcgtatagaaccagacacctctaaggacttgaag
gtttacccattgccacacatgtttgttgttaaggatttggttcctgatttgacccacttc
tacaagcaatacaagtccatccaaccatacttacaaagagacactaatccagccgatggt
agagaaaacttacaaagcattgaagacagagctaagttggatggtttgtatgaatgtatt
ttatgtgcttgttgttctacttcttgtgcctcttactggtggaaccaacaacaatacttg
ggtccagccgtcttgatgcaagcatacagatggttgattgactctagagatgaatacacc
agtaacagaaaggttatgttacaaaactccatgtctttgtacagatgtcacaccattatg
aactgtaccagaacatgtccaaaggggttgaatcctggtaaggctattgctgaaattaag
agacttttggcttttgattaa

DBGET integrated database retrieval system