KEGG   Spathaspora passalidarum: SPAPADRAFT_60259Help
Entry
SPAPADRAFT_60259  CDS       T03101                                 

Definition
(RefSeq) polyol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPAPADRAFT_60259
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SPAPADRAFT_60259
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SPAPADRAFT_60259
    1.1.1.-  
     SPAPADRAFT_60259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 18873300
NCBI-ProteinID: XP_007374430
JGI: 60259
UniProt: G3AKF8
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MTASTMKAIVYHDRGDVRYDPAFPEPNITRGDDVKIKVHYCGICGSDLKEYTDGPIFFSK
KGTNNEISNLPYPQCMGHEISGEIIEVGKDVTNVVPGDKVVVEVTGTCFDRYRFPDSPGF
DKPKCPSCHVGHYNACDYLGLTGLGFTDGGCSEYLVTAASKVIKFDENIIPMDVAALVQP
IAVSWHAVRVSRFVEGQSALILGGGPIGLTTIFALKGHKVGHIVLSEPALARRQLAEKLG
VEVFDPTGKSVEQCVTELRAMSPNGHGFNYSYDCSGVPATFETGLKTLNIRGTATNVAVW
AHKSVSYFPMETTFSEKVVTGSICFVKEDFEDSIAAIQSGLISVDELKLLITSVIKLEDG
V
NT seq 1085 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatcaactatgaaagcaattgtatatcacgatagaggggatgttcgatatgat
ccagcattccccgaaccaaacataacacgtggtgatgacgtgaagattaaagtccattat
tgtgggatctgtgggtctgacttgaaagaatataccgatggaccaattttctttagtaag
aaaggtactaataatgaaatttctaatttaccataccctcaatgtatgggacatgaaata
agtggtgaaattattgaagtgggtaaggatgttaccaatgttgttcctggtgataaagtt
gtcgttgaagtcacgggaacttgttttgatagatatagattcccagattctccaggattt
gataagccaaaatgtccaagttgtcatgtcggacattacaatgcatgtgactaccttgga
ttgactgggttggggttcactgatggtggttgttctgaatatttagttactgctgcatca
aaagtcatcaagtttgatgaaaatatcattccaatggatgttgctgcattggtacaacca
attgctgtcagttggcatgcagttagagtgtcaagatttgttgaaggtcaaagtgcattg
attttaggtggtggtcctatcggattaactaccatctttgccttgaaaggtcataaagtg
ggtcatattgttttgagtgaaccggcattggctagaagacaattggctgaaaaattaggt
gttgaagtatttgacccaactggtaaatcagttgaacaatgtgtcactgaattaagagca
atgtcaccaaatggtcacgggtttaactattcatacgattgttcaggtgtcccagcaact
tttgaaactggtttaaagactttaaatatacgaggaaccgccaccaatgttgctgtttgg
gcccataaatcagtatcatatttcccaatggaaaccacattctccgaaaaagttgttact
ggatcaatttgttttgttaaagaagattttgaagattcaattgcagcaattcaatcagga
ttaatatctgttgacgaattaaaattgttgattacttcagttataaagttggaagatggg
gttga

DBGET integrated database retrieval system