KEGG   Spathaspora passalidarum: SPAPADRAFT_60714Help
Entry
SPAPADRAFT_60714  CDS       T03101                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial precursor-specific
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00020  Citrate cycle (TCA cycle)
spaa00480  Glutathione metabolism
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
spaa01130  Biosynthesis of antibiotics
spaa01200  Carbon metabolism
spaa01210  2-Oxocarboxylic acid metabolism
spaa01230  Biosynthesis of amino acids
spaa04146  Peroxisome
Module
spaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spaa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPAPADRAFT_60714
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPAPADRAFT_60714
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPAPADRAFT_60714
Enzymes [BR:spaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SPAPADRAFT_60714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18873534
NCBI-ProteinID: XP_007374881
JGI: 60714
UniProt: G3AM13
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MIRAARSFSSTTKTLAKIKVTNPIVELDGDEMTRIIWHRIREQLVTPYLDVNLKYYDLGI
QSRDATNDQITIDAANAIKEYGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGT
VFRESIIIPRVPRLIPGWKEPIVIGRHAHGDQYKATDLVITEPGKLELTFTPANGGAPET
RTVYDYKGTGVGLAMYNTDESIRGFAHSSFKMALTKGLPLYMSTKNTILKKYDGRFKDIF
QEIYESDYAKEFEAKGLWYEHRLIDDMVAQMIKSKGGFVMALKNYDGDVQSDIVAQGFGS
LGLMTSVLMTPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIAQRGRLD
NTPDVVDFANTLEKATIDTVQEDGIMTKDLALATGRTDRASYVTTTEFLDAVADKLKTKV
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgattagagcagcacgttcattctcaagcaccaccaagactcttgctaagattaaagtc
accaacccaatcgttgaacttgatggggatgaaatgaccagaattatctggcaccgtatc
cgtgaacaattagttactccatacttagatgttaacttgaaatactacgatttaggtatt
caatctcgtgatgccaccaatgatcaaattaccattgatgctgctaatgctattaaggaa
tatggtgttggtgttaaatgtgctaccattacccctgacgaagccagagttgaagaattc
ggattaaagaaaatgtggctctctcctaacggtaccattcgtaacattttgggaggtact
gttttcagagaaagtatcatcattccaagagttcctagattaatccctggatggaaggaa
cctattgtcattggaagacacgctcatggtgatcaatataaggctactgatttggttatc
actgaaccaggaaagttggaattaaccttcactccagccaacggtggagctccagaaacc
agaactgtttacgattataagggtactggtgtcggtttagctatgtacaataccgatgaa
tctattcgaggttttgcccattcctcattcaagatggctttgaccaagggattgccattg
tacatgtctaccaagaataccatcttgaagaaatacgatggtagattcaaggatattttc
caagaaatttacgaatctgactatgctaaggaattcgaagccaagggtttatggtatgaa
catagattaatcgacgatatggttgcccaaatgatcaaatccaagggtggatttgtcatg
gcattaaagaattacgacggtgatgttcaatctgatattgttgcccaaggttttggatct
ctcgggttaatgacctccgtattgatgacccctgatggaaaggccttcgaatccgaagct
gctcacggtactgtcactagacattatagacaacatcaacaaggtaaagaaacttctacc
aactcaattgcttctatctttgcttggtccagaggtattgctcaaagaggtagattagat
aacactccagatgtggttgatttcgccaacactcttgaaaaggctactattgacactgtt
caagaagacggtatcatgaccaaggatttagctttagctactggtagaaccgatagagct
tcctatgttacaaccactgaattcttggatgctgttgctgataaattaaagacaaaggtt
gttgtatag

DBGET integrated database retrieval system