KEGG   Spathaspora passalidarum: SPAPADRAFT_61865Help
Entry
SPAPADRAFT_61865  CDS       T03101                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spaa  Spathaspora passalidarum
Pathway
spaa00250  Alanine, aspartate and glutamate metabolism
spaa00410  beta-Alanine metabolism
spaa00430  Taurine and hypotaurine metabolism
spaa00650  Butanoate metabolism
spaa01100  Metabolic pathways
spaa01110  Biosynthesis of secondary metabolites
Module
spaa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPAPADRAFT_61865
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPAPADRAFT_61865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPAPADRAFT_61865
   00430 Taurine and hypotaurine metabolism
    SPAPADRAFT_61865
Enzymes [BR:spaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SPAPADRAFT_61865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18874086
NCBI-ProteinID: XP_007376075
JGI: 61865
UniProt: G3ARH6
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MTQASISSDLESRRVEELDRLLTLLKPRILQYVESADPQSANYNPTSLGTYHEPEFLKQK
ILNGDDLAEKCSEDELFNVIDKVLEYSVNTWNPGFLDKLYASNNPIGVVSDIILSMLNTN
SHVYTVSPVLSVIENYIGRKYARLFYTKDQETCGGLTFAGGSWSNVTSLQIARSMRFPDT
KVKGNQGYKFAIYTSKHSHYSVEKAAILLGLGSENVFKIDVNAVGTMDVAKLRETIATTK
SQGYTPLYINATAGTTVFGSFDPFTEIAAVAKEFGVHFHIDGSWGGNVIFSSKYRGRLAG
CELADSITVNPHKMLGIPNTCSFLLLPHVAHFQTAMSLQAPYLFHGRESGEENYDLADGT
MGCGRRSDAFKFYMGWLYYGTAGFEARVNHAFTIMEYFVARISADSRFELVGSSKENLPQ
CLQVCFYYHPSCGCDNTKVTRFISRELHKMGKYLVDFSPNADGSDKGEFFRVVFNSPILT
NDVIDDLIDSIVKVGERCV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagctagcatcagtagtgacttggagtcacgcagggtcgaagagctcgaccgt
ctccttactttgctcaagccgcggattctccagtatgtcgaatcagctgatccgcaatcg
gcaaactacaatccaacatcgcttgggacatatcatgaacccgagtttctcaaacagaag
attttgaatggcgatgatttggccgagaagtgcagcgaggatgagttgtttaatgttatt
gataaagtgttggagtactctgtcaacacttggaacccggggttcttggacaagttgtat
gcgctgaacaaccccattggtgtggtctcggatatcatcttatccatgctcaacaccaac
tctcacgtgtacactgtatcacctgtgttatcagtgattgaaaattacattggaagaaag
tatgcgcggttgttttacactaaggaccaggaaacgtgtggtgggttgacgtttgctggg
ggatcctggtcgaacgttaccagtttgcaaattgccagatcgatgagattcccagatact
aaagtcaaagggaaccaagggtacaaatttgccatttacactagtaagcacagtcattat
tccgtggagaaagctgccattttacttggattggggtctgagaatgtgttcaagattgat
gtgaatgctgtaggaaccatggatgttgctaaattgagagagaccattgcaaccaccaag
tcacaagggtacactccgttgtacatcaatgcaacggcaggtaccactgtatttggttcg
tttgatccattcacagaaattgcagctgtggccaaggagtttggggtccatttccacatt
gatgggtcctggggaggcaatgtcatattctcgtcaaaataccgtggccgtcttgccgga
tgtgaattagctgattccatcaccgtcaacccacacaaaatgctcggtatccccaacacc
tgttcatttttgttgcttccacatgtagctcacttccaaaccgccatgtcgttgcaagca
ccgtatttattccatggccgtgagtcaggtgaggaaaactatgatttggccgatggaacc
atgggatgtggaagacgtagtgacgcgttcaagttctacatgggctggctctactacggg
accgcgggctttgaagctagagtcaaccatgcattcaccatcatggaatatttcgtggct
cgaatcagtgccgattctcgatttgagttggttggaagcagcaaggaaaaccttccccaa
tgtctccaagtttgcttttattaccatccaagctgtgggtgtgacaatacgaaagtgacg
cgattcatttccagagagttgcacaagatggggaaatatcttgttgatttcagtcccaac
gccgacggatcagataagggggagtttttccgggtggtgttcaattctccgatcttgacg
aatgacgtgattgacgatttgattgactcaattgtgaaggtgggagaacggtgtgtgtaa

DBGET integrated database retrieval system