KEGG   Sporosarcina pasteurii: E2C16_05270Help
Entry
E2C16_05270       CDS       T06007                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spae  Sporosarcina pasteurii
Brite
KEGG Orthology (KO) [BR:spae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2C16_05270 (ahpF)
Enzymes [BR:spae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E2C16_05270 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_3 DAO AlaDh_PNT_C Thi4 FAD_binding_2 K_oxygenase Glutaredoxin Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QBQ05116
LinkDB All DBs
Position
1088611..1090146
Genome map
AA seq 511 aa AA seqDB search
MNLLDKDIKAQLAQYLEMMEGDVLLKISAGTDKVSNEMIALVEELASMSSHIKVEKAELE
RTPSFSVNRVGEETGVTFAGIPLGHEFTSLVLALLQVSGRAPRVDEKVIEQVKNLEGEYH
FESYISLSCQNCPEVVQALNVMSVLNPNITHTMIDGAVFKEEVESKNVMAVPTVFLNGES
FSSGRQSIEEILAKLGSGPDASEFENKEPFDVLVVGGGPAGASAAIYAARKGVRTGIVAD
RFGGQILDTATIENFISVNRTEGPKLAASLEEHVKDYEIEVMNLQTATGLEKKDLFEIEL
ENGAVLKSKSVILSTGASWRNVGVPGEAEFRNKGVAYCPHCDGPLFEGKDIAVIGGGNSG
IEAAIDLAGIVNHVTVLEFASELKADSVLQDRLYKLPNVTVVKNAQTKEITGTDSVNGIT
YIDRDTNEEHHIELAGVFVQIGLVPNTNWLGNAVERNNFGEIIVDKRGATNVPGVFGAGD
CTDSAYKQIIISMGSGATAALSAYDYLGKTE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgttagataaagatattaaagcgcaattggcccagtatcttgaaatgatggaa
ggcgacgtactcttaaagattagcgctggtacagataaggtttcaaatgaaatgatcgca
ttagtagaagaattagcttctatgtcatctcatattaaagtagagaaagcagaattagaa
agaacgccaagctttagcgttaaccgtgtaggtgaagaaactggtgttacatttgccggt
attccacttggccatgaatttacatcattagttctagctttattacaagtaagtggtcgt
gcaccaagagtcgatgaaaaagtcattgaacaagtgaaaaatcttgaaggtgaatatcat
tttgaatcatacattagcttaagctgtcaaaactgtccggaagttgtccaagcgttaaac
gtaatgagcgtgttaaacccgaacataacacatacgatgattgacggtgcagtgtttaaa
gaagaagtagaaagcaaaaatgtgatggccgttccaacagtattcttaaatggtgagtca
ttctcaagcggacgccagtcaatcgaagaaattctcgccaaattgggcagtggacccgac
gcgtccgagtttgaaaataaagaaccattcgacgttctcgttgttgggggcggtcctgca
ggtgcaagtgccgcaatctatgcagcgcgtaaaggcgttcggacaggcattgtagcagat
cgttttggtggccaaattttagatactgcaacgattgagaactttattagtgtaaatcgt
acggaaggtccaaagcttgcagcaagccttgaagaacacgttaaagattatgagattgaa
gtaatgaatttacaaacagctaccggattagagaagaaagatttgttcgaaattgagctc
gaaaatggtgcagtactcaagagtaagtctgtgattctttcaacaggcgctagctggcgt
aacgtaggcgtcccaggagaagcagaatttagaaataaaggtgttgcctactgtccacac
tgtgacggaccgctttttgaaggaaaagatattgctgtcattggcggcggaaactcaggt
atcgaggcggctattgaccttgcaggaattgtcaaccatgtaacggtacttgagtttgct
tcggagctaaaagccgattcagttttacaagatcgactttataaacttccaaacgttact
gttgtaaaaaatgcacaaacgaaagaaattactgggacggatagcgtaaacggcattaca
tacattgaccgcgatacaaatgaagaacaccatatcgaattagcaggtgtcttcgttcaa
atcggtcttgtgccaaacacaaattggttgggcaatgcagtcgagcgtaataactttggt
gaaattatcgtcgacaaacgcggtgcaacaaacgtaccaggcgtatttggggctggagac
tgtacggatagcgcctataaacaaattatcatttcaatgggatcaggtgcaactgcagct
ttaagtgcgtacgattatctcggtaaaactgaataa

DBGET integrated database retrieval system