KEGG   Sphingomonas panacis: AWL63_03665Help
Entry
AWL63_03665       CDS       T04760                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
span  Sphingomonas panacis
Pathway
span03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:span00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AWL63_03665
Enzymes [BR:span01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AWL63_03665
DNA repair and recombination proteins [BR:span03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AWL63_03665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AOH83207
UniProt: A0A1B3Z726
LinkDB All DBs
Position
complement(801756..804206)
Genome map
AA seq 816 aa AA seqDB search
MSETDPLARYNAKRDFAKTAEPAGTLAPGHGNRFIVQKHDATRLHWDFRLEIDGVLKSWA
VTRGPSLDPNEKRLAVRTEDHPLSYADFEGTIPAGEYGGGTVMLWDSGTWAPIKGKSAKD
LEKGHLHFILDGERMKGEWLLIRLKPRGKEKGENWLLRKIDDAEAGATDALVEGALTSVT
TGRTMAEIAEGVKPKGSVRGERKAKPRSGPGLRRGDVGFQPLQLATLVDSVPAGSGWLHE
VKYDGYRALVAISGGTAKVFTRSGLDWTDKFAGIAEAAAALDVEDALIDGEIVAFKDGRP
DFSTLKDAISSGGDMTFFAFDLLALDGEDLTGLPNIARKERLRPLVSGDDARLQFAEHII
GSGEQLFETMCREGFEGVVSKRADAPYRGRRTTAWLKTKCIRRQEFVIVGWLPSDKGRGF
RSLLLGLNGADGLVYAGKVGTGFNAALIDSLSAKLARLERKTPTVTAPRAAVRGARWVSP
KLVAEVAFAEATPDGVLRHSSFIGLREDKAAKDVVAEVPVAVAEPDATPEIHVTVSSRER
LIFPESDVTKGDLADYYAQVSGVMLPWAANRPVSLVRCPQGRGKACFFQKHDAGSFGDHV
HQVPIREKDGSTENYLYIDDADGLVACVQMGTIEFHGWGSSVATLEQPDRMVFDLDPDEG
LGFDIVRKAAEDLKDHLADIGLTSFAMLSGGKGVHVIVPLTPQAEWPAVKDFADRFSRAL
SAAEPERFVATMSKAKRKDRIFIDWLRNQRGATAVLPYVARARAGAPVAAPVSWAELREI
DRANRWGVRDVAELIDRARSRALAGWGFADQVLPDL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccgatcccctcgcccgctacaatgccaagcgcgatttcgcgaagaccgcc
gagcccgccggcacgctcgcgcccggtcatggcaaccgcttcatcgtccagaagcacgat
gcgacccggctgcactgggacttccggctcgaaatcgacggcgtgctcaagagctgggcg
gtgacgcgcgggccgagcctcgatccgaacgagaaacggctggcggtgcggaccgaggac
catccgctgtcctatgccgatttcgaggggacgattccggcgggcgaatatggcggcggc
acggtgatgctgtgggacagcggcacctgggcgccgatcaaaggcaaatcggcgaaggat
ctcgagaaggggcatctccacttcatcctcgatggcgagcggatgaagggcgagtggctg
ctgatccggctgaagccgaggggcaaggagaagggcgagaactggctgctgcgcaagatc
gacgacgccgaggccggggcgaccgatgcgctggtggagggcgcgctgacgagcgtgacg
accgggcggacgatggcggagatcgcggaaggggtgaagccgaaggggtcggttcggggt
gagcgcaaggccaagccacgcagcggccccggcctgcgccggggcgacgtcgggtttcag
ccgctccagcttgccacgcttgtcgattctgtccccgccggatcgggctggctgcatgag
gtgaaatacgacggctatcgcgcgctcgtcgccatatcgggcggcacggccaaggtgttc
acccgctcggggctcgactggaccgacaagttcgccggcatcgccgaagccgccgccgcg
ctcgacgtggaggatgcgctgatcgatggcgagatcgtcgcgttcaaggatgggcggccc
gatttctcgacgctcaaggatgcgatttccagcggcggcgacatgaccttcttcgcgttc
gacctactcgcgcttgacggtgaggatctcaccgggctgcccaatatcgcgcgcaaggaa
cggctgcgtccgctcgtcagcggtgacgatgcgcggctccagttcgccgagcatatcatc
ggcagcggcgagcaactgttcgagacgatgtgccgcgaggggttcgagggcgtcgtgtcg
aagcgcgccgatgcgccgtatcgcgggcggcggacgaccgcctggctcaagaccaaatgc
atccgccggcaggagttcgtcatcgtcggctggctgccgtccgacaaggggcgggggttc
cgctcgctgctgctcgggctgaacggcgcggacgggctggtctatgccggcaaggtcggc
accggcttcaatgcggcgctgatcgactcgctttcggccaagctcgcccggctggagcgc
aagacgccgaccgtcaccgcgccgcgcgcggcggtgcgcggcgcgcgctgggtcagcccc
aagctggtcgccgaggtcgcctttgccgaggcgacgcccgacggcgtgctgcggcattcg
agcttcatcgggcttcgcgaggacaaggcggcgaaggatgtggtggcggaggtgccggtc
gcggtggcggaaccggatgcgacgcccgagatccacgtcaccgtcagcagccgcgagcgg
ctgatctttcctgagtcggacgtgaccaagggcgatctcgccgactattacgcgcaggtc
tcgggcgtcatgctgccgtgggcggcgaaccgtccggtcagtctggtgcggtgcccgcag
gggcgcggcaaggcgtgttttttccagaagcatgacgctggcagcttcggcgatcacgtc
catcaggtgccgatccgcgagaaggacggatcgaccgagaattatctctatatcgacgac
gccgatggcctcgtcgcgtgcgtgcagatgggcacgatcgagttccacggctggggatcg
tcggtggcgacgctcgaacagcccgaccggatggtgttcgatctcgaccccgacgagggg
ctgggcttcgatatcgtgcgcaaggcggcggaggatctgaaggaccatctcgccgacatc
ggcctcaccagcttcgcgatgctgtcgggcggcaagggcgtgcatgtcatcgtgccgctg
acgccgcaggccgagtggccggcggtgaaggatttcgccgatcgcttctcgcgcgcgctc
agcgccgccgagccggagcggttcgtcgcgaccatgtccaaggccaagcgcaaggaccgt
atcttcatcgactggctgcgcaaccagcgcggcgcgacggccgtgctgccctatgtggcg
cgcgcgcgcgccggtgcgccggtggcggcgccggtaagctgggcggaattgcgcgagatc
gaccgcgccaatcgctggggcgtgcgcgacgtggcggaactgatcgaccgcgcccgatcg
cgcgcgcttgccggctggggcttcgccgatcaggtgctgcccgatctgtga

DBGET integrated database retrieval system