KEGG   Sphingomonas panacis: AWL63_03880Help
Entry
AWL63_03880       CDS       T04760                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
span  Sphingomonas panacis
Pathway
span00620  Pyruvate metabolism
span00680  Methane metabolism
span01100  Metabolic pathways
span01120  Microbial metabolism in diverse environments
span01200  Carbon metabolism
Module
span_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:span00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWL63_03880
  Energy metabolism
   00680 Methane metabolism
    AWL63_03880
Enzymes [BR:span01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AWL63_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOH86497
UniProt: A0A1B3ZGE9
LinkDB All DBs
Position
complement(859271..861937)
Genome map
AA seq 888 aa AA seqDB search
MAELPSIANNPDVRFLGKLLGDVIRAYGGEMLFKRTEYIRAASVDRHRGVAGGEVDLGLG
SLSLDETLDFVRGFMLFSMLANLAEDRHGVAAEKGADVASALARLAEEGIDKSAVMALLD
HALIVPVLTAHPTEVRRKSMIDHRNRIAELMALKDAGLAETPEGDDVEEAIYRQIALLWQ
TRVLRRERLYVTDEVETALSYLRDVFLPTLPALYQRWDRALGERTPSFLRPGSWIGGDRD
GNPFVTADSLRTALGRSCEAVIGFYLEALSELGAELSISSELASVDESVLALAEASGDTG
PSRSDEPYRRALTGIYARLAATHLKLTGKAAARPAAVKGEPYADPQALRSDLVAIARALR
AGGAGALSSGGALGRLIRAVETFGFHLATLDMRQNSAVHERVVAELLKVAGVEDDYRALG
ESQRVSLLRHELSNARPLTSPFADYSDETQSELAIVRAAAEAHAKYGPGCITNYIVSMAQ
SVSDLLEINVLLKEVGLYRPGASPTAAIMAVPLFETIGDLEAAPEIMTEWFALPEAGAIT
RARGFQEVMIGYSDSNKDGGYLTSTWSLSKASTALKAVFEQAGVGMQLFHGRGGAVGRGG
GSSFAAIRAQPDGTVQGRIRITEQGEVIAGKYGTRESAMVNLEAMTAATLLATLEPVSAA
DQARFAGAMERISQDAFTAYRDLVYGTEGFRTFFRQMTPLTEIAGLKIGSRPASRTKSDK
IEDLRAIPWVFSWAQARVMLPGWYGVGQALAAFEDKGLIAEMAQGWPFFAAMLGNMEQVI
AKSDMGIAERYAALVEDRALAQAIFPRIRDGWQVTYDALLAATGQSHLLEKHPALDASIR
LRLPYIEPLNMLQIELIKRRRAGEEDERVGVGILLSINAIATALRNSG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcttccctcgatcgcgaacaaccccgacgtgcgtttcctgggcaagctgctc
ggcgacgtcatccgtgcctatggcggcgagatgctgttcaagcggaccgagtatatccgc
gccgcctcggtcgaccggcatcgcggtgtcgcggggggcgaggtcgatctcggcctcggc
agtctcagcctcgacgagacgctcgatttcgtgcgcgggttcatgctgttctcgatgctc
gccaatctcgccgaggatcgccacggcgtcgccgccgagaagggcgcggatgtcgcctcg
gcgctggcgcggctcgccgaggaggggatcgacaagagcgcggtgatggcgctgctcgat
catgcgctgatcgtgccggtgctgaccgcgcacccgaccgaggtgcggcgcaagtcgatg
atcgaccatcgcaatcgcatcgccgagctgatggcgctgaaagatgcgggcctcgccgag
acgcccgagggcgacgatgtcgaggaggcgatctaccgccagatcgctttgctgtggcaa
acgcgcgtgctgcggcgcgagcggctgtacgtgaccgacgaggtcgagaccgcgctcagc
tatctgcgcgacgtgttcctgccgacgctgcccgccttgtaccagcgctgggaccgcgcg
cttggcgagcgcacgccgagtttcctgcggccgggaagctggatcggcggcgaccgcgac
ggcaatccgttcgtcaccgccgattcgctgcgcacggcgctcgggcggtcgtgcgaggcg
gtgatcggattctatctggaggcgctgagcgaactcggcgccgaactgtcgatttcgagc
gaactggcgagcgtcgacgaatcggtgctggcgctggccgaggcgagcggcgacaccggc
ccgagccgaagtgacgagccgtaccggcgcgcgctgaccggcatctacgcgcggctggcg
gcgacgcatctgaagctcaccggcaaggcggcggcgcggccggctgcggtgaagggggaa
ccctatgccgatccgcaggcgctgcgctccgatctggtcgcgatcgcgcgggccttgcgg
gccggcggggcgggggcgctgtcgagcgggggtgcgctcgggcggctgattcgcgcggtc
gagacgttcggcttccacctcgccacgctcgacatgcgccagaacagcgcggtgcatgag
cgtgtggtggcggaactgctcaaggtggcgggggtcgaggacgattaccgcgcgctgggc
gaatcgcagcgggtgtcgctgctgcgccacgaactgtccaacgcgcggccgctgaccagc
ccgttcgccgactattcggacgagacgcaaagcgaactggcgatcgtgcgcgcggcggcc
gaggcgcatgccaaatacgggccgggctgcatcaccaattacatcgtgtcgatggcgcag
tcggtgtcggatctgctcgagatcaacgtgctgctcaaggaagtcgggctgtaccggccg
ggcgcatcgccgaccgccgcgatcatggcggtgccgctgttcgagacgatcggcgatctc
gaggcggcgcccgagatcatgaccgaatggttcgctttgcccgaggccggcgcgatcacg
cgcgcgcggggcttccaggaagtgatgatcggctattccgattcgaacaaggacggcggc
tatctcacctcgacctggtcgctctcgaaggcatcgactgcgctcaaggcggtgttcgag
caggcgggcgtcggcatgcagctcttccacggtcgtggcggcgcggtcgggcggggcggc
ggctcgtcgttcgcggcgatccgtgcgcagcccgacggcaccgtgcagggccgcatccgc
atcaccgaacagggcgaggtgatcgcgggcaaatacggcacgcgcgagagcgcgatggtc
aatctcgaagcgatgacggcggcgaccctgctcgccacgctggagccggtgtcggcggcg
gatcaggcgcggttcgcgggcgcgatggagcggatttcgcaggatgcgttcaccgcgtac
cgcgatctcgtctacggcaccgaggggttccgcaccttcttccgccagatgacgccgctg
accgagatcgccggcctcaagatcggctcgcgcccggcgagccgcaccaaatcggacaag
atcgaggatctgcgcgcgatcccctgggtgttcagctgggcgcaggcgcgggtgatgctg
ccgggctggtacggcgtcgggcaggccctggcggcgttcgaggacaaggggctgatcgcc
gaaatggcgcaaggctggccgttcttcgcggcgatgctcggcaacatggagcaggtgatc
gccaaatccgacatggggatcgccgagcgctatgcggctttggtcgaggatcgcgcgctc
gcgcaggcgatcttcccgcgcatccgcgacggctggcaggtgacgtatgacgcgctgctg
gcggcgacggggcagtcgcatctgctggagaagcatccggccctggatgcgtcgatccgg
ttgcggctgccgtatatcgagccgctcaacatgctccagatcgagcttatcaagcgccgc
cgcgcgggcgaggaggacgagcgggtcggggtggggattctgctgtcgatcaacgcgatc
gcgacggcgttgcggaattccggctag

DBGET integrated database retrieval system