KEGG   Sphingomonas panacis: AWL63_03965Help
Entry
AWL63_03965       CDS       T04760                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
span  Sphingomonas panacis
Pathway
span00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:span00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AWL63_03965
Enzymes [BR:span01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AWL63_03965
Transporters [BR:span02000]
 Other Transporters
  Pores ion channels [TC:1]
   AWL63_03965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AOH86499
UniProt: A0A1B3ZGF3
LinkDB All DBs
Position
complement(879293..879964)
Genome map
AA seq 223 aa AA seqDB search
MWQLYQFPLCPFSRKVRLLLGEKGVGYELVRESPWARRDEFIDMNPAGQVPVMTDQARNL
LLIDSMAICEYFEETIDKSAMISGSAAYRAEIRRQVAWFDAQFFADVTAPLLHERMEKRL
VTRVAPDSKVLREAMRAAVRHLDYTDYLLDHNNWMAGSTMTLADLAAAAHISVVDYLGGI
DWKNHEQTARWYRGLKSRPSFRPLLSERMDGIQPTSHYDDVDF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaactgtatcaatttccgctctgtccgttctcgcgcaaggtccgtctgctgctt
ggtgagaagggtgtcggctatgagctcgtgcgcgaatcgccttgggccaggcgcgacgaa
ttcatcgatatgaaccccgccggccaggtgccggtgatgaccgatcaggcgcgtaacctg
ctgctgatcgattcgatggcgatctgcgagtatttcgaagagaccatcgacaagagcgct
atgatctccggctccgccgcctatcgcgccgagatccgcaggcaggtcgcgtggttcgat
gcgcaattcttcgcggatgtgaccgcgccgttgctccacgagcggatggaaaagcggctc
gtcacgcgagtggcgcccgattcgaaggtgctgcgcgaagcgatgcgcgcggcggtgcgg
catctcgactataccgactacctgctcgatcataacaattggatggcgggatcgacgatg
acgctcgccgatctggcggcggccgcgcatatctcggtggtcgattatctcggcggcatc
gattggaagaaccacgaacagaccgcacgctggtatcgcgggttgaagagccggccgagc
ttccgcccgctattgtccgagcggatggacggcatccagccgacctcgcattacgacgat
gtcgatttctga

DBGET integrated database retrieval system