KEGG   Sphingomonas panacis: AWL63_08470Help
Entry
AWL63_08470       CDS       T04760                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
span  Sphingomonas panacis
Brite
KEGG Orthology (KO) [BR:span00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AWL63_08470
Enzymes [BR:span01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AWL63_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Thi4 FAD_binding_3 HI0933_like NAD_binding_8 NAD_binding_7 AlaDh_PNT_C FAD_binding_2 K_oxygenase Glutaredoxin FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AOH83997
UniProt: A0A1B3Z9A5
LinkDB All DBs
Position
complement(1891397..1892989)
Genome map
AA seq 530 aa AA seqDB search
MLDANVTQQLKTYLVNITQPIELVASLDDSPKSKEMGALLNDIAALSDKITVVDGVDARK
PSFMIRRVGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAADLIEQVKNLDGDFTFE
TYFSLTCQNCPDVVQALNLMAVLNPRIKHTAIDGALFKAEVEERKVMAVPTVFLNGAPFA
SGRMELEQIVAKIDTAAESRAAEKIKTKAPFDVLIVGGGPAGAAAAIYTARKGIRTGVVA
DRFGGQVLDTMGIENFASVPHTEGPKFAADLERHVRDYDVDIMNLQRAEKVIPASEAGGL
HEVQLANGASLKTRTLILSTGARWRQMNVPGEDTYKNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDTDLRADAVLQRKLASLPNVKIITSALTTEVLGDGE
KVSGLVYKDRNHDTLHQIELEGIFVQIGLVPNTEFLRDTVALSPRGEIEVDHRGETSRPG
IFAAGDATTVPYKQIVIAAGDGAKAALSAFDYLIRNEPVEAAEQELVAAE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatgtgacacagcagctcaagacctatctggtcaacatcacgcagccg
atcgagctggtcgcgtcgctcgacgactcgcccaagtcgaaggaaatgggtgcgctgctg
aacgatatcgccgcgctttccgacaagatcaccgtcgtcgacggcgtcgatgcgcgcaaa
ccgagcttcatgatccgccgcgtcggcaccgatatcggcgtgcgcttcgccggtctgccg
atggggcatgaattcaccagcctcgtgctcgcgctgctccaggtcggcggacatccgtcg
aaggcggcggcagacctgatcgagcaggtcaagaatctcgacggcgatttcaccttcgag
acctatttctcgctgacctgccagaactgccccgacgtggtccaggcgctcaacctgatg
gcggtgctcaacccgcgcatcaagcacaccgcgatcgacggcgccttgttcaaggccgag
gtcgaggagcgcaaggtgatggcggtgccgaccgtgttcctcaacggtgcgccgttcgcc
agcggccgcatggaactggagcagatcgtcgccaagatcgacaccgccgcggaaagccgc
gccgccgagaagatcaagaccaaggcgccgttcgacgtgctgatcgtgggtggtggcccc
gccggtgcggcggctgcgatctacaccgcgcgcaagggcatccgcaccggcgttgtcgcc
gatcggttcggcgggcaggtgctcgacacgatggggatcgagaacttcgcctcggtgcca
cacaccgaaggccccaagttcgccgccgatctcgagcgccatgtccgcgactatgacgtc
gacatcatgaacctccagcgcgccgagaaggtgatcccggcgagcgaagccggtggtctc
catgaggtgcaactcgccaatggtgcgagcctgaagacgcggacgctgatcctttcgacc
ggcgcgcgctggcggcagatgaacgtgcccggcgaggacacgtacaagaacaagggcgtg
gcgtactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatcggc
ggcggcaattcgggcgtcgaagccgcgatcgatctcgccgggatcgtcgcgcacgtcacg
ctgatcgaattcgacaccgatctgcgcgccgatgcagtgctccagcgcaagcttgccagc
ctgcccaacgtcaagatcatcacctcggcgctgaccaccgaagtgctgggcgacggcgag
aaggtttcggggctggtctacaaggatcgcaaccacgacacgctgcatcagatcgaactg
gaaggcatcttcgtccagatcgggctggtgccgaacaccgagttcctgcgcgacacggtc
gccttgtcgccgcgtggcgagatcgaggtcgatcatcgcggcgaaacctcgcgccccggc
atcttcgcagcgggcgacgcgacgacggtgccgtacaagcagatcgtcatcgcggcgggc
gacggcgcgaaggctgcgctctcggcgttcgattacctgatccgcaacgagccggtcgag
gcggcggagcaggaactggtcgcggcggagtaa

DBGET integrated database retrieval system