KEGG   Sphingomonas panacis: AWL63_08975Help
Entry
AWL63_08975       CDS       T04760                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
span  Sphingomonas panacis
Pathway
span00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWL63_08975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:span02000]
    AWL63_08975
Enzymes [BR:span01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AWL63_08975
Transporters [BR:span02000]
 Other Transporters
  Pores ion channels [TC:1]
   AWL63_08975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOH86648
UniProt: A0A1B3ZGU1
LinkDB All DBs
Position
1998440..1999078
Genome map
AA seq 212 aa AA seqDB search
MASDLVLYTNPMSRGRTARWMLEEVGAPYEAVVLDYASSMKGLEYLAINPMGKVPAIVHR
GKVVTEVAAICAYLADAFPEAGLAPPPAERADYYRWLFFAAGPVEQAFTNKSLGVTPTDQ
QKRMVGYGCFEQTIDALEAAVSATHYVTGDTFTAADVYVGAQIGFMLQFGMLEPRPAFVA
YWNRVSARDAFKRAAAVDDALIAAAQEATAEG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgacctggttttatataccaacccgatgtcgcgcgggcggacggcacgctgg
atgctcgaagaggtcggcgcgccgtatgaggcggtggtgctcgactacgcatcgtcgatg
aaggggctcgaatatctggcgatcaacccgatggggaaggtgccggcgatcgtccaccgc
ggcaaggtcgtcaccgaggtcgcagcgatctgcgcgtatctggcggatgccttcccggag
gccgggctggcgccgccaccggccgagcgggccgactattatcgctggctgttcttcgcg
gcggggccggtcgagcaggcgttcaccaacaagtcgctcggcgtgacgcccaccgaccag
cagaagcgcatggtcggctatggctgtttcgagcagaccatcgacgcgttggaggcggcg
gtttcggcgacgcattatgtgaccggcgatacgttcaccgccgccgacgtctatgttggt
gcgcagatcgggttcatgctccagttcggcatgctcgaaccgcgcccggcgttcgtggcg
tattggaaccgcgtctccgcccgtgatgcgttcaagcgcgccgccgcagtcgacgacgcg
ctgatcgccgccgcgcaggaggccacagcggagggctga

DBGET integrated database retrieval system