KEGG   Sphingomonas panacis: AWL63_11000Help
Entry
AWL63_11000       CDS       T04760                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
span  Sphingomonas panacis
Pathway
span00010  Glycolysis / Gluconeogenesis
span00620  Pyruvate metabolism
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AWL63_11000
   00620 Pyruvate metabolism
    AWL63_11000
Enzymes [BR:span01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AWL63_11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AOH84415
UniProt: A0A1B3ZAF8
LinkDB All DBs
Position
2470956..2472467
Genome map
AA seq 503 aa AA seqDB search
MTVHQPITARTAPFKTRYGNFIGGAWVEPIDGRYFENRSPIDGQVICEVPRSNAADIERA
LDAAHAAKEAWGRTSPAERALILNRIADRMEECLAELATAETWDNGKPIRETTAADVPLA
IDHFRYFAGCIRAQEGGISEIDHDTVGYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVIKPAEQTPASILVWAERIGDLLPPGVLNIVNGFGLEAGKPLAQSRRIAKIAFTGE
TSTGRLIMQYASESLIPVTLELGGKSPNIFFADVADEDDDFFDKAIEGFAMFALNQGEVC
TCPSRALIHERVYDRFMERALKRVEAMVQGDPLDPATMVGAQASRDQMEKILSYFDIGRG
EGAEVLTGGSRNVIDGLDGYYVKPTVLKGDNTMRVFQEEIFGPVVSVTTFKDDAEALSIA
NDTLYGLGAGVWTRDGTRAYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKM
MLDHYQQTKNLLVSYSPKKLGFF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagtccatcagcccatcacggcgcgcacggcgccgttcaagacgcgatacggcaat
ttcatcggcggcgcctgggtcgaacccattgacggccgctatttcgagaatcgctcgccg
atcgacgggcaggtgatctgcgaggttccccgcagcaacgccgccgatatcgagcgcgcg
cttgacgccgcacatgccgccaaggaggcttggggccgcaccagcccggccgagcgcgcg
ctgatcctgaatcgcatcgccgatcgcatggaagagtgcctcgccgaactcgccaccgcc
gagacatgggacaacggcaaaccgatccgcgagaccaccgccgccgacgttccgctagcg
atcgatcatttccggtatttcgccggctgcatccgcgcgcaggaaggcggcatttccgag
atcgaccacgacaccgtcggctatcatttccatgagccgctcggcgtcgtcgggcagatc
atcccgtggaatttcccgctgctgatggcctgctggaaactggcgccggcgctcgccgcg
ggcaattgcgtcgtcatcaagccggccgagcagaccccggcctcgatcctcgtgtgggcc
gaacggatcggcgatctgctgccgccgggcgtgctcaacatcgtcaacggcttcgggctg
gaggcgggcaagccgctggcgcagtcgcggcgcatcgccaagatcgctttcaccggcgag
acgtcgaccggccggctcatcatgcaatatgcctccgaaagcctgatcccggtcacgctc
gaactgggcggcaagagccccaacatcttcttcgcggatgtcgccgatgaagacgacgac
ttcttcgacaaggcgatcgaggggttcgccatgttcgcgctcaaccagggcgaggtctgc
acgtgcccgagccgcgcgctgatccacgagcgcgtctatgatcgcttcatggagcgcgcg
ctcaagcgggtcgaggcgatggtgcagggcgatccgctcgatcccgcgacgatggtgggc
gcgcaggcatcccgcgaccaaatggaaaagatcctctcgtatttcgacatcggccgcggc
gaaggcgccgaggtgctgaccggcgggagccgcaacgtgatcgacggtctcgacggctat
tacgtcaagccgaccgttctcaagggcgacaacacgatgcgggttttccaggaggagatc
ttcggcccggtcgtatcggtgacgacgttcaaggacgatgccgaggcgctgtcgatcgcc
aacgacacgctgtacgggctcggcgccggcgtatggacgcgcgacggcacccgtgcctac
cgcatgggccgggcgatccaggcgggccgggtgtggaccaactgctaccacgcctatccc
gcgcatgcggcgttcggcggctacaaacagtccggcatcggccgcgagaatcacaagatg
atgctcgaccattaccagcagaccaagaacctgctggtcagctacagcccgaagaagctt
ggcttcttctaa

DBGET integrated database retrieval system