KEGG   Sphingomonas panacis: AWL63_11870Help
Entry
AWL63_11870       CDS       T04760                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
span  Sphingomonas panacis
Pathway
span00473  D-Alanine metabolism
span00550  Peptidoglycan biosynthesis
span01100  Metabolic pathways
span01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWL63_11870
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AWL63_11870
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AWL63_11870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:span01011]
    AWL63_11870
Enzymes [BR:span01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AWL63_11870
Peptidoglycan biosynthesis and degradation proteins [BR:span01011]
 Precursor biosynthesis
  Amino acid ligase
   AWL63_11870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOH84562
UniProt: A0A1B3ZAW0
LinkDB All DBs
Position
2638986..2639921
Genome map
AA seq 311 aa AA seqDB search
MSKPLHIAVLMGGWSAEREVSLMSGTGVADALESRGHRVTRIDMDRDVAAKLAAAKPDVV
FNALHGTPGEDGSVQGLLDLMGLTYTHSGLATSVIAIDKQLTKLLLVPAGIPMPGGRIVK
SETLYDADPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIGRDVAGPWTEFDELLAEPYI
RGRELTTAVLGGQALGVTELKPKNGWYDFDAKYTEGLTEHICPAQIPYDVADACKRIALD
AHRVLGCKGASRSDFRWDDERGIDGLFLLEVNTQPGMTPLSLVPEQARHLGMSYAELVQA
IVDEALEGAAP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcccctccatatcgccgtcctcatgggcggctggtcggccgagcgcgaggtt
tcgctgatgtcgggcaccggcgtcgccgatgcgctcgaatcgcgcggccaccgcgtcacg
cggatcgacatggaccgcgacgtggcggcgaagctcgccgccgccaagcccgatgtcgtc
ttcaacgcgctccacggcacccccggcgaggacggttcggttcagggcctgctcgatctg
atggggctgacatacacgcatagcggtctcgccacctcggtcatcgcgatcgacaagcag
ctcaccaagctgctgctcgtccccgccggtatccccatgccgggcggccgcatcgtcaag
tccgagacgctctacgacgccgatccactgccgcgcccctatgtcctcaagccggtcaac
gaaggctcttcggtcggcgtcgcgatcgtcacggcggagggcaattacggcaatccgatc
ggccgcgatgtcgccggcccgtggacagagttcgacgaattgctcgccgaaccctacatc
cggggccgcgaactgaccacggcggtgctgggtgggcaggcgctcggcgtcaccgagttg
aagcccaagaacggctggtatgatttcgacgcgaaatacaccgaggggctgaccgaacat
atctgccccgcgcagatcccctacgacgtcgccgacgcctgcaaacgcatcgcgctcgac
gcgcaccgtgtgctcggctgcaagggcgcgtcgcgctccgatttccgctgggatgacgag
cgcggtatcgacgggctgttcctgctggaagtcaacacccagcccggcatgacgccgctc
agcctcgtgcccgaacaggcgcgccacctcggcatgagctatgccgaactcgtccaggcg
atcgtcgacgaagcgcttgaaggcgccgcgccgtga

DBGET integrated database retrieval system