KEGG   Sphingomonas panacis: AWL63_21145Help
Entry
AWL63_21145       CDS       T04760                                 

Definition
(GenBank) para-aminobenzoate synthase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
span  Sphingomonas panacis
Pathway
span00400  Phenylalanine, tyrosine and tryptophan biosynthesis
span00405  Phenazine biosynthesis
span01100  Metabolic pathways
span01110  Biosynthesis of secondary metabolites
span01130  Biosynthesis of antibiotics
span01230  Biosynthesis of amino acids
span02024  Quorum sensing
Module
span_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:span00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AWL63_21145
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AWL63_21145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AWL63_21145
Enzymes [BR:span01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AWL63_21145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Herpes_UL21
Motif
Other DBs
NCBI-ProteinID: AOH86988
UniProt: A0A1B3ZHS9
LinkDB All DBs
Position
4635629..4636213
Genome map
AA seq 194 aa AA seqDB search
MILVIDNYDSFTWNLVHYLMELGAEVKVVRNDALSARDAVASNAQGFLISPGPKTPTEAG
ISLDLVAACAEAGKPLMGVCLGHQAIGQHFGGSVVRGGLMHGKTSPVVHDGTGLFEGLPS
PFTATRYHSLIVEDLPADLIVNARADDGSVMGVRHATLPIHGVQFHPESIATEHGHALLA
NFVRLAGIDVKALA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgtcatcgacaattatgacagcttcacctggaacctcgtccattatctgatg
gagcttggcgcggaggtgaaggtggtccgcaacgacgccctctccgcgcgcgacgcggtc
gcgagcaacgcgcagggtttcctgatctcgcccggccccaagacgccgacggaggcgggc
atcagcctcgatctcgttgccgcctgcgcggaggccggcaagccgctgatgggcgtgtgc
ctcggccatcaggcgatcggccagcatttcggcggcagcgtcgtgcgcggcgggctgatg
cacggcaagacctcgccggtcgtccacgacggtaccgggctgttcgagggcctgccctcg
cccttcaccgccacccgctaccattcgctgatcgtcgaggatctccccgccgacctgatc
gtcaacgcccgcgccgacgacggttcggtgatgggcgtgcgccacgcgacgctcccgatc
cacggcgtccagttccatcccgagagcatcgccaccgaacacggccacgccctgctcgcc
aatttcgtgcggctcgcggggatcgacgtgaaggcgctcgcgtga

DBGET integrated database retrieval system