KEGG   Saprolegnia parasitica: SPRG_01778Help
Entry
SPRG_01778        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
spar  Saprolegnia parasitica
Pathway
spar04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPRG_01778
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spar04121]
    SPRG_01778
Enzymes [BR:spar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     SPRG_01778
Ubiquitin system [BR:spar04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    SPRG_01778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CHY zf-RING_2 zf-RING_11 zf-RING_UBOX YL1
Motif
Other DBs
NCBI-GeneID: 24124359
NCBI-ProteinID: XP_012195534
UniProt: A0A067CTR0
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MSCDHYKRGCHLFAECCNQWFPCRVCHNEAQDGHEMDRHAVTRVRCRKCFTEQPPQQTCS
KCSFVLGKYFCSVCNLFDDEGDEKGIFHCNDCGICRVGGRDKFFHCMTCGGCYAQDRRDK
HVCINQAMRQECCICYESLFEARESPSVLPCGHVLHGACYDEMTKYQYGQITFCPQTHMP
CSIACPLCRKSLLSERAQRRLERLMRREAAADGSEAGNEGGEDDGSSHEGPVVVFADDDG
DDVFSASDVDDSDISDSEMSDVDDGESSHSIEDVQAPTDGTQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgaccactacaagcgcggttgccacctcttcgccgaatgctgtaaccagtgg
ttcccttgccgcgtgtgccacaacgaggctcaggatgggcacgagatggaccgccacgcc
gtgacgcgcgtgcgttgccgcaagtgctttacggagcagccaccgcagcagacctgctcc
aagtgctcctttgtgctcggcaagtacttttgcagcgtttgcaacctctttgacgacgag
ggcgacgagaaaggcatcttccactgcaacgattgcggcatctgccgtgtcggtggccgc
gacaagttctttcactgcatgacgtgcggcggctgctacgcccaggatcgacgggacaag
cacgtatgcatcaaccaggcaatgcgccaggaatgctgcatctgctacgagagcttgttc
gaagcgcgggaaagtccctctgtgcttccatgcggccacgtccttcacggcgcctgctat
gatgagatgacgaagtaccagtacggccaaatcacattttgcccgcaaacgcacatgcct
tgtagcattgcttgtccgctttgtcgcaaatcgctgctctcggagcgcgcccagcgacgc
ctggaacggctgatgcgccgcgaggctgctgccgacgggtccgaggccggcaacgaaggt
ggcgaggacgacggaagcagccatgaggggcccgtcgtggtttttgccgacgacgatggc
gatgacgtctttagcgcgagtgacgtggacgactcggatatcagcgatagcgaaatgagc
gatgtggacgacggcgagagcagccacagcatcgaagacgtgcaagcgccgaccgatggc
acccaatag

DBGET integrated database retrieval system