KEGG   Saprolegnia parasitica: SPRG_05142Help
Entry
SPRG_05142        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
spar  Saprolegnia parasitica
Pathway
spar00562  Inositol phosphate metabolism
spar01100  Metabolic pathways
spar04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPRG_05142
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPRG_05142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spar01009]
    SPRG_05142
Enzymes [BR:spar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SPRG_05142
    3.1.3.48  protein-tyrosine-phosphatase
     SPRG_05142
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     SPRG_05142
Protein phosphatases and associated proteins [BR:spar01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    SPRG_05142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 24127547
NCBI-ProteinID: XP_012199136
UniProt: A0A067CT28
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MCERAKLQLGTMEIKPSMRHGPVTVLSPSSHTGSFGSSAPASPAGLKKPSSMSTSLFSLQ
LKKLVSRKKRRFIEDGFDLDMTYVTSRLIAFGYPAENLEGMYRNHYKDVFNCFEHRHKDH
YKVYNLCSERHYDKDKFHNRVAEYPFDDHNPPPLSLLIPACQDIFEWLAQHPDNVAAIHC
KAGKGRTGVMICAYLLYSSTWLTAYGAMGFYGGARSLNHQGVTIPSQRRFIEYFASMCHK
DQPEEAKQAEMHLTHADFGQLWEKQWLTDDRASDSSFMSSGRISNEQLVALPKVFERLAL
PKPVNYKLVSCVIHGLYPKKKPDMHVFVQVGFDKALQYNLSVAGTTQVSMDDACESMQVD
KLEIVCPMDRQTLLCGEVKVELRKRQGGKPLGHFWFHTSFLDPARPQLTVQKADMDVLLK
DVKKGHKKFAESMHIVLTMAPA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaacgggccaagttgcagcttggaacgatggagatcaagccgtcgatgcgacat
ggaccggtgaccgtgctgagcccgagcagccacacgggcagcttcgggagctcggcgccg
gcgtcgcccgcgggactgaagaagccgagctccatgtccacgtcgctcttctcgctccag
ctcaagaagctcgtgtcgcgcaagaagcggcggttcatcgaagatggcttcgacctcgac
atgacgtatgtgacgtcgcgcctcattgcgttcgggtatccggcggagaacctcgagggc
atgtaccgcaaccactacaaggacgtcttcaactgctttgagcatcgccacaaagaccat
tacaaagtctacaatctgtgctcggagcgccactacgacaaggacaagtttcacaaccga
gtcgccgagtacccgttcgacgaccacaacccaccgccgctgtcgctcctcattcctgcc
tgccaagacatctttgagtggcttgcgcagcaccccgacaacgttgcagcgatccactgc
aaagctggcaagggacgcaccggcgtcatgatctgcgcctacctcttgtacagctcgacg
tggctcacggcatacggcgccatgggcttttacggcggcgcccggtcgctcaaccaccaa
ggcgtgacgatcccgagccagcggcgcttcatcgagtactttgccagcatgtgccacaag
gatcaacccgaagaagccaaacaagccgagatgcatttgacgcacgcagactttgggcag
ctctgggagaagcagtggctcaccgacgaccgtgcgagcgacagctccttcatgtcgtcg
ggccgcatttcaaacgagcagctcgtcgcgcttcccaaagtgtttgagcgcctcgcgctg
cccaagcccgtcaactacaagctcgtgtcgtgcgttatccacggcctgtacccaaagaag
aagcctgacatgcacgtcttcgtgcaagtgggcttcgacaaggcgctgcagtacaacctc
tcggtcgcgggcacgacacaagtgtcgatggatgacgcgtgcgagagcatgcaagtggac
aagctcgagattgtgtgcccgatggaccgccaaacgctgctgtgcggcgaagtcaaggtc
gagcttcgcaagcgccaaggcgggaagcccctcggccacttttggttccacacgtcgttc
ttggacccggcgcggccgcagcttaccgtacagaaagccgacatggacgtgctgctcaag
gacgtcaagaagggccacaaaaagtttgccgagagcatgcatatcgtgctcaccatggcg
cctgcgtaa

DBGET integrated database retrieval system