KEGG   Saprolegnia parasitica: SPRG_07154Help
Entry
SPRG_07154        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spar  Saprolegnia parasitica
Pathway
spar00500  Starch and sucrose metabolism
spar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPRG_07154
Enzymes [BR:spar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPRG_07154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 24129453
NCBI-ProteinID: XP_012201339
UniProt: A0A067CM31
LinkDB All DBs
Position
Unknown
AA seq 1009 aa AA seqDB search
MRGASIVLAAAVASALGANPVIYEISTRPWLYELSLKYNRPMSLDDPSALALIQKELLAL
KAAYNPDYIWMMGVWQLGAYGLNLDQTTKNDEFNSILPGWTKDDVIGSPYAVANYTCNPS
IGTDDDLRALKSFLNANKMKLMLDFVPNHVAVDHPWACSQPEFLLPLDQADLGSHSCAKG
PTVRPPCSARSFYTGGDYWNSGWVDTVQLNYWNPALRSAQIDTLSHIASLADGIRCDMAM
SVLNREIELAWVKDNRNGNSCSTGSQGRMPTKFASSPPTTEFWADAIPVLKAKYPSLFLM
AENYNYGFTPTPEDLYLQSLGFDVTYDMDALKTIDAMPIGSGKANFVNLVRASSTKYAKS
VHFVENHDDNRAAGTLFNYKASAARAAALAVTSLPGSKLFFHGQFDCNPNRLAVQLRRGV
SFKPDAYCQTWFADLLQTLTDDVHTRGNWLGIDSAPFSSTDGSDVISYKWQYNCTERLVV
ANYRDAWSNVRIPLAFPKIADKNTLVTVSERLLEQRSLSDPEHFDSQVYDYSICPASAAT
PATTTATPATTTVPVKTPAACTSPVTDGRNRTAAAWKERSVYQILTDRFAGAPSSGACKD
LSTYCGGTFNGIKNNLQYIRGMGFDAIWISPVIDNSPGGYHGYWARDWDKINAHFGTPAE
LQALVDAAHALDMWVMVDVVTNHVAPVGSDFRSIVPFNDPAHYHPSCEITDWNNQTMVET
CRLSGLPDLDQSNAFVRSYLLKWIKKLVADYGFDGVRVDTVPEVAKDFWAEFNTAAGVFQ
VGEVFNGDPKYVGSYQPSVSSVFNYPMSFTIGDVFGAGQSMKAIKSRVDGNSNYADPTIL
GSFVDNHDNPRFMHKYPNKQAQLRAATVFSLTTEGIPFVYYGTEQYYGGGVDPANREALW
TNLDTTSDLYKILSVVHRQRKKSQIWLSPWVERYAADNFYSFSRGAFLVALTNSNAQQHV
KVTYHPFKDGDIVCNIFWPKDDCQTVAGGVDIYLNNGESKIYVLKSMLA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgcaagcatcgtcctcgccgcggccgtcgcgtcggcgctcggggctaacccg
gtcatctacgagatctcgacgcgcccgtggctctatgagctctcgctcaagtacaaccgg
cccatgtcgctcgacgatccgtctgcgctcgcgctcatccagaaggagctgctggcactc
aaggccgcttacaaccccgactacatctggatgatgggggtgtggcagctcggtgcatac
ggcctgaacctcgaccagaccaccaagaacgacgagtttaattcgattctgcctggctgg
accaaggatgacgtgatcgggtcgccgtacgcagtggccaactacacgtgcaacccgtcg
atcgggacggacgacgacctccgcgcgctcaagtcatttttgaacgccaacaaaatgaag
ctcatgcttgactttgtgcccaaccacgtcgcggtggaccatccgtgggcgtgctcgcag
cccgagttcctcctcccgctcgaccaggccgacctcgggtcgcactcgtgcgccaagggc
ccgaccgtccgtccgccatgcagcgcccggtcgttctacacgggcggcgactactggaac
tcggggtgggtcgacaccgtccagctcaactactggaacccggcgctccggtcggcgcag
atcgacacgctctcgcacattgcgagcttggccgacggcattcgctgtgacatggccatg
tcggtcctcaaccgcgagatcgagctcgcttgggtcaaggacaaccgcaacggcaacagc
tgctccacgggatcgcaaggccgcatgccgaccaagtttgcgtcatcgccgccaacgacg
gagttttgggccgacgcgatcccggtgctgaaggccaagtacccgagtctctttttgatg
gccgagaactacaactatggctttacgccgacgccggaggacctctacctccagtccctc
ggctttgacgtcacgtacgacatggacgcgctcaagacgatcgatgcgatgccgatcggg
tcggggaaggccaactttgtcaacctcgtgcgcgcgagcagcaccaagtacgccaagtcc
gtgcactttgtcgagaaccatgatgacaaccgcgcggccggtacgctcttcaactacaag
gcgtcggcggcgcgggcagcggcgctcgccgtcacgtcgctccccggctccaagctcttt
ttccatgggcagtttgactgcaacccgaaccgcctcgccgtgcagctccgacgcggcgtc
tcgttcaagcccgacgcgtactgccaaacgtggttcgccgatctgctgcagacgctcacg
gacgatgtacacacgcgcggcaactggctcggcatcgactcggcgccgttctcgtcgacc
gacggcagcgacgtcatctcgtacaagtggcagtacaactgcaccgagcgcctcgtggtg
gccaactaccgcgacgcgtggagcaacgtccgcattccgctggcctttcccaagattgcc
gacaagaacacgctcgtgaccgtctcggagcgcctccttgagcagcggtctctcagtgat
cctgagcactttgacagccaagtgtacgactactcgatctgcccggcgtcggcggctact
cccgcgacgacgacggctactcccgcgacgacgacggttcccgtcaagacccccgcagcg
tgcaccagccctgtgacagatggccgcaaccggaccgcggcggcatggaaggagcgctcg
gtctatcagattttgaccgaccgcttcgcgggcgcaccgtcgtcgggtgcctgcaaggac
ctctcgacgtattgcggtggcacgttcaacggcatcaagaacaacctccagtacatccgc
ggcatgggctttgacgcgatctggatcagccccgtcatcgacaacagccccggcgggtac
cacggctactgggcgcgcgactgggacaagatcaacgcgcatttcggcacgccagccgag
ctccaggcgctcgtggatgcggcccacgcgctcgacatgtgggtcatggtcgacgtcgtc
accaatcacgttgcgcccgtcggcagtgactttcgctcgatcgtgccgttcaacgacccg
gcgcactaccacccgtcgtgcgagatcaccgactggaacaaccagacgatggtcgagacc
tgccgtctctcgggcctcccggacctcgaccaatcgaacgcgtttgtgcgctcgtacctc
ttgaagtggatcaagaagctcgtggccgactacggctttgacggcgtccgcgtcgacacg
gtgcccgaagtcgccaaggacttttgggccgagttcaacaccgccgccggtgtcttccag
gtcggcgaggtcttcaacggtgaccccaagtacgtgggcagctaccagccgtcggtcagc
agcgtcttcaactaccccatgtccttcacgattggcgacgtctttggcgctggccagagc
atgaaggcgatcaagtcgcgcgtcgacggcaacagcaactacgccgatccgaccatcctc
gggtccttcgtcgacaaccacgacaacccgcgctttatgcacaagtacccgaacaagcag
gcgcagctccgggccgcgaccgtcttctcgctcacgaccgaaggcatcccgttcgtttac
tacggcaccgaacagtactacggcggcggcgtcgacccggccaaccgcgaggcgctctgg
accaacctcgacacgacgtccgacttgtacaagattctctcggtggttcaccgccagcgc
aagaagtcccagatctggctctcgccgtgggtcgagcggtacgcggccgacaacttttac
agtttcagccgcggcgcgttcctcgtcgcgctcaccaactcgaacgcgcagcagcacgtc
aaggtgacgtaccatccgttcaaggacggcgacattgtctgcaacatcttttggcccaag
gacgactgccaaacggtcgcggggggcgtcgacatttacctcaacaacggcgagagcaag
atctacgttctcaagtcgatgctcgcctaa

DBGET integrated database retrieval system