KEGG   Saprolegnia parasitica: SPRG_08588Help
Entry
SPRG_08588        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K08142  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 3
Organism
spar  Saprolegnia parasitica
Brite
KEGG Orthology (KO) [BR:spar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spar02000]
    SPRG_08588
Transporters [BR:spar02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   SPRG_08588
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    SPRG_08588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12
Motif
Other DBs
NCBI-GeneID: 24130802
NCBI-ProteinID: XP_012203222
UniProt: A0A067C5Y4
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MATMQHSQSDVSLGTSGAWAEIKKEEGMRKRSNTAQNLQFYVEEQKRLYQELPFMALPGM
RRQSFQRERSFSNLKSKSSWGSFGSITNLVARGDETQALLPDTRGEPGYTVPLLLSCCVA
LMSAFQFGYNTGVTGALNPNVIFPDDVKTPDQKSFEWSICVSVWAIGGPLGSIVAGNLSQ
KYGRKKTLILDCFLFIFSGALMACAVNIYWLILGRFLVGFAAGIVSVVVPLYLGELAPPN
LRGALGTGYQFGVVLGILAADIMAFGFSDYSTGIAHPGWRFMFGFTIIPAFLQLALASFL
TESPRWLLTQNKPKEAAEILRRLRGTTDVYEEIDSICSASDNENSGMTMWQVLGDKSIRF
PLIVGVTLQIAQQLSGINAVMFYASSFFQGVHLSNPLVGTTLVGVVNVVSTGVALVLMDT
AGRRPLLLWSCGGMILSCVVLTLGLWQLLPYYEMVSVGGVMLFVWFFEIGLGPIPWLIVA
EMFPAKPRPTAMALATMVNWLFSFVIGITFPMLQNHLLENSFVPFGIALVLAFIFTFKYV
PETKGKTLEEIQQDMAHM
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatgcagcacagccagtcggacgtgtccctagggacgtccggcgcatgggcc
gagatcaagaaggaagagggcatgcgcaagcgctccaacacggcgcagaaccttcagttc
tacgtcgaggagcagaagcgcctgtaccaggaattgccgttcatggcactgccgggtatg
cgccggcagtcgtttcagcgcgagcgcagcttctcgaacctcaagagcaagagctcgtgg
ggcagctttggcagcatcaccaacttggtcgcgcgcggcgacgaaacgcaggcgttgcta
cccgacacgcgcggcgagccgggctacaccgtgccgctcctgctctcgtgctgcgtggcg
ctcatgagcgcgttccagtttggctacaacacgggcgtcaccggcgccttgaaccccaac
gtgattttccccgacgacgtcaagacgccggaccagaagagtttcgagtggtcgatttgc
gtctcggtctgggcgattggcggtcccctcggctcgatcgtcgccggcaacctcagccaa
aagtacggtcgcaagaagacgctcatcttggactgcttcctctttatcttttccggcgcg
ctcatggcgtgcgcggtcaacatttactggctcatcctcggccgcttcctcgtcgggttt
gcggccggtatcgtgagcgtcgtcgtgcccttgtaccttggcgagctcgcgccgcccaac
cttcgtggtgcgctcggtacggggtaccagtttggcgtcgtcttgggcatcttggcggcc
gacattatggcctttggcttctcggactatagcacgggcattgcgcaccccggctggcgc
ttcatgtttggctttacgatcatcccggccttcttgcagttggcgctggcgtcgttcttg
acagagtcgcctcgttggctcttgacgcagaacaagcccaaggaagcggccgaaatcctg
cgccgcttgcgcggcacgaccgacgtgtacgaggaaatcgacagcatttgctcggccagc
gacaatgaaaactcgggcatgaccatgtggcaggttctcggcgacaagagcattcgcttc
ccgctcatcgtcggcgtcacgctccaaatcgcgcagcagctctcgggcatcaacgccgtc
atgttttacgcgagctcgttcttccagggcgtgcacctctccaacccgctcgttggcacg
acgcttgtcggtgtcgtcaacgtcgtttcgacgggcgttgcgctcgtgctcatggacacg
gcgggccgtcgcccgctgctgctctggtcgtgcggtggcatgatcctctcgtgcgtcgtt
ctcacgctcggcttgtggcaactgctgccgtactacgagatggtcagcgtcggcggcgtc
atgctctttgtgtggttctttgaaatcggtctcggcccgatcccgtggctgatcgtcgcc
gaaatgtttcccgccaagccgcgcccgaccgcgatggcgctcgcaaccatggtcaactgg
ctctttagctttgtgattggcatcacgttcccgatgctccaaaaccatttgctcgaaaac
tcgtttgtgccgtttggcattgcgctcgtcctcgccttcatctttacgttcaagtacgtg
cccgagaccaagggcaagacgctcgaagagatccagcaggacatggcgcacatgtag

DBGET integrated database retrieval system