KEGG   Saprolegnia parasitica: SPRG_08796Help
Entry
SPRG_08796        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
spar  Saprolegnia parasitica
Pathway
spar03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPRG_08796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spar03400]
    SPRG_08796
DNA repair and recombination proteins [BR:spar03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SPRG_08796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I XPG_I_2
Motif
Other DBs
NCBI-GeneID: 24131002
NCBI-ProteinID: XP_012203416
UniProt: A0A067CGA7
LinkDB All DBs
Position
Unknown
AA seq 1013 aa AA seqDB search
MGVTGLWMLLAAGGREVSIESLSGQTLAVDASIWLTQFVKAMRDPEDGSMLRNAHLLGTF
QRVAKLLFHGIRPVFVFDGDTPAIKLRTLQRRRARREKNQLSLTQTAQKLLLRQLERRAK
QAVVEEETKTEPDVIHINDDEEGEEEKKAAESPPPMPSEEENDDDDAIAEWRDHQEHVEA
FQRERRQEAREQFLTLAGKPEEYSLAQIQTFLKSSRFKREMKEQAAAANTTEAGRRIASE
ADRRYILTTANDARPAPPPAAVATDAQLLDASDSTVGLFSEYVQKQSQSQPIQRAPKILH
VDDDDDEVLIGAHGKPVVLKTDHPQWMLPKKKTSQRRGVVWEHKPDGSLVASLDPTKMQL
TAEEASILPPSLFDIDVARPQAPVKDEHIEWGDEVEAKDALVSDSDTEWEDVVTQPSNTA
PVAAPAAPITVDGGDDDDVEWLDVTPSAVPSAEIATVHATAQAASDDLPALPVPNSGTSH
AAVDVDDAASPSTALVASHDAIVIDDTSDVEDNWQDVLPPEAFAAPRPTPLDTLRPSTKV
EKPLGVGSPKATAFVVPDAALERATWNAEATPPSSPVLRPSATVLDADALGAWNDEDNLF
ERRVSKALSADDDDDVVSLGLARNDDALQAVMTTASNLTQWAAGAIKRAIRDHQQKHGGK
PLEDDATPRYLSRTTPTEPPAPVVVDSGRFLVADDGGETDAQLKRSRNQQMRDVDGVTDE
MQNDVMELLRLFGVPFIVAPMEAEAQCATLEKLGLVTGVITDDSDIFAFGGQRVYKNMFK
TSKFVEAFSMTDIERELGLDQESMIALALLLGSDYTDGIHGVGVVNATEIVHAFPGLDGL
REFKAWVHDFDLAAQLKPLPKLSEAELKALSPLERFKHTHHKVRRNWHIADAFPNAHVIK
AYQEPETDRSDARFSWSTPDLANLRIFCGRTFGWPLEKVNATLLPIVQAATRGWSKTQTR
IDSYFTSYKDGVKYAKIRSKRLQAVVQDIHETLEKQAPTKRRKRKVANAETTD
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgacggggctatggatgctgcttgccgcgggtggccgcgaggtttcgatcgag
agcttgagcgggcaaacgctggccgtggacgcgagcatctggctcacgcagttcgtcaag
gccatgcgcgatccggaggatggcagcatgctgcgcaacgcgcacttgcttggcaccttc
cagcgagttgcgaagctcctcttccatggcatacgacccgtctttgtcttcgatggtgac
acgcccgcgatcaagctgcgcacgttgcagcgtcgccgcgcccggcgcgagaagaaccag
ctctcgctcacgcaaacggcgcaaaagttgctcctgcgccagctcgagcggcgagccaag
caggctgtcgttgaagaagagaccaagacggagcccgacgtcatccatatcaacgacgac
gaagaaggagaagaggaaaagaaggcggccgagagcccgccgcccatgccaagtgaggaa
gagaacgacgacgacgatgcgattgccgaatggcgagatcaccaggagcatgttgaagcc
ttccaacgtgagcgtcgtcaagaagcccgcgagcagttcttgacgcttgcgggcaagccg
gaagagtactcactcgcgcagattcagacgttcctcaagtcgagccgcttcaagcgcgag
atgaaggagcaggcggcggccgcgaacaccaccgaagccggccgccgcatcgcgagcgaa
gccgaccgccggtacatcctcacgactgcgaacgacgctcgaccggcgcctccgcctgcc
gctgtcgcgaccgatgcgcagctcctcgacgcgtcggactcgacggttgggctcttctcc
gagtatgtgcagaagcagtcgcagtcgcagccgatccaacgagcgccaaagattttgcac
gtcgacgacgacgacgacgaggtcctcatcggtgcccacggcaaaccagtcgttctaaag
acggaccacccgcagtggatgctgccgaagaagaagacgtcgcagcggcgcggtgtcgtc
tgggaacacaagccggacggcagtctcgtggcatcgctcgatccgaccaagatgcagctc
acggccgaggaagccagcattttgccgccctctctgttcgacattgacgttgcacgcccc
caggctccagtcaaggacgaacacatcgagtggggcgacgaggtcgaggccaaagacgcg
ctcgtgagcgactcggacacggagtgggaggatgtcgtgacgcaaccaagcaacaccgcg
cccgtggccgctcctgctgcgccgatcaccgtcgatggtggcgacgacgacgacgtggaa
tggctggatgtcacaccaagcgcagtgccgagtgctgaaattgcaacggtccacgcgaca
gcacaggcggccagcgacgaccttccagcgctcccagtcccaaactcgggtacctcacac
gcggcagtcgatgtcgacgacgctgcatcaccgagcacagctcttgtcgcaagccacgac
gccatcgtcattgacgacacttcggacgtcgaagacaactggcaggacgtactgccgccc
gaggcctttgctgcgccacgtccgacgccgctggatacgctacgtccttcgaccaaggtc
gagaagcctctgggagtcgggagtccgaaagccaccgcgtttgtggtacctgacgctgcg
ttggaacgagcgacatggaacgcggaggcgacaccgccatcgtcgccggtgctccgaccg
tcggcgaccgtgctcgacgcagacgccctcggcgcctggaacgacgaggacaaccttttt
gagcggcgcgtgtccaaggctttgtctgctgacgacgacgatgacgttgtctcgcttgga
ctggcccggaacgacgatgcgctgcaggcagtcatgacgacggcctccaacctcacgcaa
tgggctgctggcgccatcaagcgggcgatccgggaccatcagcaaaagcatggtggcaaa
ccgcttgaggacgacgcgacacctcggtacctctcgcggacgacgccaaccgagccgccc
gcgcccgtcgttgtcgactcgggccggttccttgttgcagacgatggcggtgagacggac
gcgcagctcaagcgatcgcggaaccagcagatgcgcgatgtcgacggcgtcacggacgag
atgcagaacgacgtcatggagctgctgcggctctttggtgttccgttcattgtggcgccg
atggaggccgaggcgcagtgcgccacgctcgaaaagctcggtcttgtgacgggcgtcatc
acggacgacagtgatattttcgcgtttggcggccaacgcgtctacaaaaacatgttcaaa
acctccaagtttgtcgaagccttctcgatgaccgacattgagcgcgaactcgggctcgac
caagagagcatgatcgccctcgcgctgctcctcggcagtgactacacggacggcatccat
ggcgtcggtgttgtcaacgccaccgagatcgtccacgcatttccgggtctcgacggcctt
cgcgagttcaaggcatgggtgcacgacttcgaccttgcggcgcagctaaagccactaccc
aagctatcggaagccgagctcaaggcgctttcgcctctcgagcgcttcaagcacacgcat
cacaaggtccggcgcaactggcacattgccgacgcctttcccaacgcgcacgtcatcaag
gcgtatcaagagcccgagacggaccgatcggacgcgcgcttctcctggtcgacaccggat
cttgccaacttgcgcatcttttgcggccgcacgtttgggtggccgctggagaaggtgaac
gcgacgctactgccgatcgtgcaggcggcgacgcgcggctggtcgaagacgcaaacacgc
atcgacagctacttcacctcgtacaaggacggcgtcaagtatgccaagattcgcagcaag
cgactccaagccgtcgtccaggacatccacgagactctggaaaagcaggcgccgaccaaa
cgccggaagcgcaaggtcgccaacgctgaaaccaccgactaa

DBGET integrated database retrieval system