KEGG   Saprolegnia parasitica: SPRG_14325Help
Entry
SPRG_14325        CDS       T04137                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
spar  Saprolegnia parasitica
Pathway
spar00020  Citrate cycle (TCA cycle)
spar00190  Oxidative phosphorylation
spar01100  Metabolic pathways
spar01110  Biosynthesis of secondary metabolites
spar01130  Biosynthesis of antibiotics
spar01200  Carbon metabolism
Module
spar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spar_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPRG_14325
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPRG_14325
Enzymes [BR:spar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPRG_14325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18 SF3a60_bindingd Fer4_9
Motif
Other DBs
NCBI-GeneID: 24136134
NCBI-ProteinID: XP_012208843
UniProt: A0A067BQB4
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MMQTRLLARSSAIGARSFAAAAADLKLQAPATKNVKYFKIYRWDPETKEKPYLCTYPVDL
NECGPMVLDALLKIKNEQDPTLTFRRSCREGICGSCAMNIDGGNTLACLSPIDKKTDTTK
IYPLPHMYVIRDLVPDMNNFYEQYKSIKPWLQSDVVKDDNTEYLQSKEDRKKLDGMYECI
LCACCSTSCPSYWWNPDKYLGPAVLMQAFRWIEDSRDTKTQERLAALDDTYKLYRCHTIM
NCTKTCPKHLNPAKAIGKIKKMLSPL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaactcgtctcctggcccgctcgtccgccatcggcgcgcgctccttcgcggcc
gcggctgccgacctcaagctccaggcgccggcgaccaagaacgtcaagtacttcaagatc
taccgctgggaccccgagacgaaggagaagccgtacttgtgcacgtacccggtcgacctc
aacgagtgtggccccatggtgttggacgcgctcctcaagatcaagaacgagcaggacccg
accttgaccttccgccgctcgtgccgtgaaggtatctgcggctcatgcgccatgaacatt
gatggcgggaacacgcttgcgtgcttgtcgccgatcgacaagaagacggacacgaccaag
atttacccgttgccgcacatgtatgtcatccgcgacttggtgcccgacatgaacaacttc
tacgaacaatacaaatcgatcaagccgtggctgcagtcggatgtggtcaaggacgacaac
acggagtacttgcaatccaaggaagaccgcaagaagttggatggcatgtacgagtgcatc
ctctgcgcgtgctgcagcacgtcgtgcccgagctactggtggaaccccgacaagtacctc
ggccctgccgtcctcatgcaagcgttccgctggattgaagactcgcgcgacaccaagacg
caggagcgtctcgccgcgttggacgacacgtacaagctgtaccgttgccacacgatcatg
aactgcaccaagacgtgccccaagcacttgaacccggccaaggccattggtaagatcaag
aagatgctctcgcccttgtaa

DBGET integrated database retrieval system