KEGG   Saprolegnia parasitica: SPRG_18230Help
Entry
SPRG_18230        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
spar  Saprolegnia parasitica
Brite
Enzymes [BR:spar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     SPRG_18230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 24139755
NCBI-ProteinID: XP_012213056
UniProt: A0A067BNH3
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MDFARWKRTTTALGPQVPADAAELDKALPVHIPDFGETIPTGKARITWLGHASVLLEVPV
DENGTTATILTDREFWIGPKRYRPTPLQVADLPRIDDVVLSHNHYDHMESTTLTQLHERF
PALCWFVPLDNAHYLTPLGVGGSFFFSGNTAYCSSFKAIGHTFGGFSVSAIPIGAYGRAR
SSAFSIAMCPRPFRSTRTSRPGRRWVFTGVRGSWRNLEPKMELERLMACEMECLHDSFYT
LDH
NT seq 730 nt NT seq  +upstreamnt  +downstreamnt
atggactttgcccggtggaagcggactaccactgcgctcgggccgcaagtgcccgcagac
gccgccgagctcgacaaggcgctgccggtgcatataccagactttggcgagaccattccg
actggcaaagcccgcattacgtggctcggccacgcctctgtgctactcgaagtcccggtc
gatgaaaacggaacgaccgcaacgattctcacggaccgcgagttttggattggccccaag
cggtaccgccccacgccgcttcaagtcgcggacctcccgcgaatcgatgatgttgttctg
agccacaaccactacgaccacatggagagcacgacactcacacagctccatgaacggttc
ccagccctttgctggtttgtgccgctggacaacgcccattacttgacgccgctcggcgtc
ggcggctccttcttcttctcgggtaacacggcctactgctcgtcattcaaggcgattggc
cacacgttcggcggctttagcgtctcggcgatcccgatcggcgcgtacggccgcgcgagg
tcttccgcgttcagcattgcgatgtgcccgaggccattcagatccacaaggacgtccaga
cccggtcgtcgctgggtattcactggggtacgtgggtcatggcggaacctcgagccaaaa
atggagttggagcggctcatggcgtgcgagatggagtgcctccacgactcgttttacacc
cttgaccacg

DBGET integrated database retrieval system